BLASTX nr result
ID: Cinnamomum24_contig00029260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029260 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK85826.1| hypothetical protein SETIT_020742mg [Setaria ital... 69 7e-10 >gb|KQK85826.1| hypothetical protein SETIT_020742mg [Setaria italica] Length = 74 Score = 68.9 bits (167), Expect(2) = 7e-10 Identities = 36/46 (78%), Positives = 36/46 (78%) Frame = +3 Query: 6 TCIAII*MTRYLLGFWGIIIRLCRRDGRVVQGVALELLCRLLFTEG 143 TC TRY L FW II RLCRRDGRVVQGVALELLCRLLFTEG Sbjct: 8 TCTCRDTKTRYSLSFWSII-RLCRRDGRVVQGVALELLCRLLFTEG 52 Score = 21.2 bits (43), Expect(2) = 7e-10 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 184 PTTMYQIK 207 PTTMYQIK Sbjct: 67 PTTMYQIK 74