BLASTX nr result
ID: Cinnamomum24_contig00028982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00028982 (221 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CSD41531.1| Uncharacterised protein [Vibrio cholerae] 63 7e-08 >emb|CSD41531.1| Uncharacterised protein [Vibrio cholerae] Length = 88 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = -1 Query: 161 QVPRFPPQSSCGISPTFAGLSPTTGYVPMHYSPVRRSPP--GLPPRCRSTCMC 9 +VP F CGIS F LSP+TG P HYSPVRRSPP +P CRSTCMC Sbjct: 36 KVPCFALARLCGISHRFQWLSPSTGQFPRHYSPVRRSPPKEQVPLCCRSTCMC 88