BLASTX nr result
ID: Cinnamomum24_contig00028824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00028824 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010261461.1| PREDICTED: putative pentatricopeptide repeat... 140 5e-31 ref|XP_008800173.1| PREDICTED: putative pentatricopeptide repeat... 140 5e-31 ref|XP_010092020.1| hypothetical protein L484_000761 [Morus nota... 137 2e-30 ref|XP_010097884.1| hypothetical protein L484_011483 [Morus nota... 136 7e-30 ref|XP_007038897.1| Tetratricopeptide repeat (TPR)-like superfam... 136 7e-30 ref|XP_010933339.1| PREDICTED: putative pentatricopeptide repeat... 134 3e-29 ref|XP_012486525.1| PREDICTED: putative pentatricopeptide repeat... 132 1e-28 ref|XP_004234215.1| PREDICTED: putative pentatricopeptide repeat... 132 1e-28 ref|XP_009781104.1| PREDICTED: putative pentatricopeptide repeat... 130 4e-28 ref|XP_009781103.1| PREDICTED: putative pentatricopeptide repeat... 130 4e-28 ref|XP_006366638.1| PREDICTED: putative pentatricopeptide repeat... 130 5e-28 ref|XP_010550535.1| PREDICTED: putative pentatricopeptide repeat... 129 7e-28 ref|XP_010550534.1| PREDICTED: putative pentatricopeptide repeat... 129 7e-28 emb|CDP05112.1| unnamed protein product [Coffea canephora] 129 7e-28 ref|XP_003634110.1| PREDICTED: putative pentatricopeptide repeat... 129 7e-28 emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] 129 7e-28 ref|XP_007219220.1| hypothetical protein PRUPE_ppa017678mg, part... 129 9e-28 ref|XP_009621680.1| PREDICTED: putative pentatricopeptide repeat... 129 1e-27 gb|KDO56163.1| hypothetical protein CISIN_1g008276mg [Citrus sin... 129 1e-27 ref|XP_010035686.1| PREDICTED: putative pentatricopeptide repeat... 129 1e-27 >ref|XP_010261461.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Nelumbo nucifera] Length = 680 Score = 140 bits (352), Expect = 5e-31 Identities = 63/83 (75%), Positives = 74/83 (89%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LF+KMQ SGL PDHIAFVSVLSACSH GLL EG+++F LM EY ++PRIEHF+CMVDLL Sbjct: 396 LFTKMQHSGLTPDHIAFVSVLSACSHTGLLDEGRYYFRLMTEEYMLVPRIEHFSCMVDLL 455 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAGH+ EAY+FIK+MP+EPNER Sbjct: 456 GRAGHVDEAYDFIKQMPMEPNER 478 >ref|XP_008800173.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Phoenix dactylifera] Length = 688 Score = 140 bits (352), Expect = 5e-31 Identities = 65/83 (78%), Positives = 76/83 (91%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LF +MQESGLKPDHIAFVSVL+ACSHAGLL EG+++F M ++YQM+PRIEHFACMVDLL Sbjct: 404 LFEQMQESGLKPDHIAFVSVLAACSHAGLLDEGRYYFKCMTDQYQMVPRIEHFACMVDLL 463 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG IVEAY+FI++M IEPNER Sbjct: 464 GRAGCIVEAYDFIRQMSIEPNER 486 >ref|XP_010092020.1| hypothetical protein L484_000761 [Morus notabilis] gi|587951653|gb|EXC37464.1| hypothetical protein L484_000761 [Morus notabilis] Length = 815 Score = 137 bits (346), Expect = 2e-30 Identities = 60/83 (72%), Positives = 76/83 (91%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LF KMQ+SGL PD +AFVSV+SACSHAGLL+EG+++F LM+ EY+++PRIEHF+CMVDLL Sbjct: 394 LFEKMQDSGLSPDSVAFVSVISACSHAGLLEEGKYYFRLMIGEYKIVPRIEHFSCMVDLL 453 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY+F+K+MPIEPNER Sbjct: 454 GRAGRVEEAYSFVKEMPIEPNER 476 >ref|XP_010097884.1| hypothetical protein L484_011483 [Morus notabilis] gi|587883564|gb|EXB72481.1| hypothetical protein L484_011483 [Morus notabilis] Length = 678 Score = 136 bits (342), Expect = 7e-30 Identities = 59/83 (71%), Positives = 75/83 (90%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LF KMQ+SGL PD +AFVSV+SACSH GLL+EG+++F LM+ EY+++PRIEHF+CMVDLL Sbjct: 394 LFEKMQDSGLSPDSVAFVSVISACSHVGLLEEGKYYFRLMIGEYKIVPRIEHFSCMVDLL 453 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY+F+K+MPIEPNER Sbjct: 454 GRAGRVEEAYSFVKEMPIEPNER 476 >ref|XP_007038897.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590673458|ref|XP_007038898.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508776142|gb|EOY23398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508776143|gb|EOY23399.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 677 Score = 136 bits (342), Expect = 7e-30 Identities = 62/83 (74%), Positives = 74/83 (89%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+MQ+SGL PD IAFVSVLSACSHAGLL++G HFFNLM +Y++IP +EHFACMVDLL Sbjct: 393 LFSEMQDSGLTPDSIAFVSVLSACSHAGLLEQGWHFFNLMTEQYKIIPSVEHFACMVDLL 452 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GR+G + EAYNFI++MPIEP ER Sbjct: 453 GRSGQVEEAYNFIRQMPIEPTER 475 >ref|XP_010933339.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Elaeis guineensis] Length = 690 Score = 134 bits (337), Expect = 3e-29 Identities = 62/82 (75%), Positives = 74/82 (90%) Frame = -3 Query: 247 FSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLLG 68 F +MQESGLKPDHIAFVSVL+ACSHAGLL EG+++F M ++YQMIPR+EHFACMVDLLG Sbjct: 407 FEQMQESGLKPDHIAFVSVLAACSHAGLLDEGRYYFKRMQDQYQMIPRLEHFACMVDLLG 466 Query: 67 RAGHIVEAYNFIKKMPIEPNER 2 R+G I EAY FI++MP+EPNER Sbjct: 467 RSGCIEEAYAFIRQMPMEPNER 488 >ref|XP_012486525.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Gossypium raimondii] gi|763770112|gb|KJB37327.1| hypothetical protein B456_006G199900 [Gossypium raimondii] Length = 675 Score = 132 bits (332), Expect = 1e-28 Identities = 60/83 (72%), Positives = 73/83 (87%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFSKMQ GL PD IAFVSVLSACSHAGLL +G +FFNLM ++++++PR+EHF+CMVDLL Sbjct: 391 LFSKMQNLGLTPDSIAFVSVLSACSHAGLLDQGWYFFNLMTDQHKIVPRVEHFSCMVDLL 450 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GR+G + EAYNFI+KMPIEP ER Sbjct: 451 GRSGQVEEAYNFIRKMPIEPTER 473 >ref|XP_004234215.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Solanum lycopersicum] Length = 695 Score = 132 bits (332), Expect = 1e-28 Identities = 60/83 (72%), Positives = 74/83 (89%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+M ESGL+PD IAFVS+LSACSHAGLL EG+H++ LM ++Y+++PR+EH+ACMVDL Sbjct: 411 LFSQMLESGLQPDSIAFVSILSACSHAGLLLEGEHYYKLMTDKYKIVPRLEHYACMVDLK 470 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAGHI EA+NFIK MPIE NER Sbjct: 471 GRAGHINEAFNFIKHMPIEANER 493 >ref|XP_009781104.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 isoform X2 [Nicotiana sylvestris] Length = 537 Score = 130 bits (327), Expect = 4e-28 Identities = 58/83 (69%), Positives = 74/83 (89%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFSKM ESGL+PD IAFVSVLSACSHAGL++EG++++ LM N Y+++PR+EH+ACMVDL Sbjct: 253 LFSKMLESGLQPDSIAFVSVLSACSHAGLVQEGEYYYRLMTNNYKIVPRLEHYACMVDLK 312 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG I EAYNF+K++P+E NER Sbjct: 313 GRAGRINEAYNFVKQIPVEANER 335 >ref|XP_009781103.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 isoform X1 [Nicotiana sylvestris] Length = 677 Score = 130 bits (327), Expect = 4e-28 Identities = 58/83 (69%), Positives = 74/83 (89%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFSKM ESGL+PD IAFVSVLSACSHAGL++EG++++ LM N Y+++PR+EH+ACMVDL Sbjct: 393 LFSKMLESGLQPDSIAFVSVLSACSHAGLVQEGEYYYRLMTNNYKIVPRLEHYACMVDLK 452 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG I EAYNF+K++P+E NER Sbjct: 453 GRAGRINEAYNFVKQIPVEANER 475 >ref|XP_006366638.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Solanum tuberosum] Length = 677 Score = 130 bits (326), Expect = 5e-28 Identities = 59/83 (71%), Positives = 73/83 (87%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+M ESGL+PD IAFVS+LSACSHAGLL EG+H++ M ++Y+++PR+EH+ACMVDL Sbjct: 393 LFSQMLESGLQPDSIAFVSILSACSHAGLLLEGEHYYKQMTDKYKIVPRLEHYACMVDLK 452 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAGHI EA+NFIK MPIE NER Sbjct: 453 GRAGHINEAFNFIKHMPIEANER 475 >ref|XP_010550535.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 isoform X2 [Tarenaya hassleriana] Length = 571 Score = 129 bits (325), Expect = 7e-28 Identities = 59/82 (71%), Positives = 73/82 (89%) Frame = -3 Query: 247 FSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLLG 68 FSKMQESGL PD IAFVS+LSACSHAGLL+EG++ F LM + Y++ PRIEHFACMVD+LG Sbjct: 288 FSKMQESGLVPDSIAFVSILSACSHAGLLEEGRYHFKLMTDHYKIAPRIEHFACMVDILG 347 Query: 67 RAGHIVEAYNFIKKMPIEPNER 2 RAG + EAY+F+++MP+EPNER Sbjct: 348 RAGKMKEAYSFVQEMPMEPNER 369 >ref|XP_010550534.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 isoform X1 [Tarenaya hassleriana] Length = 685 Score = 129 bits (325), Expect = 7e-28 Identities = 59/82 (71%), Positives = 73/82 (89%) Frame = -3 Query: 247 FSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLLG 68 FSKMQESGL PD IAFVS+LSACSHAGLL+EG++ F LM + Y++ PRIEHFACMVD+LG Sbjct: 402 FSKMQESGLVPDSIAFVSILSACSHAGLLEEGRYHFKLMTDHYKIAPRIEHFACMVDILG 461 Query: 67 RAGHIVEAYNFIKKMPIEPNER 2 RAG + EAY+F+++MP+EPNER Sbjct: 462 RAGKMKEAYSFVQEMPMEPNER 483 >emb|CDP05112.1| unnamed protein product [Coffea canephora] Length = 672 Score = 129 bits (325), Expect = 7e-28 Identities = 59/82 (71%), Positives = 74/82 (90%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+MQES + PD IAFVS+LSACSHAGLL+EG+HF+ LM EY+++PR+EHFACM+DLL Sbjct: 389 LFSEMQES-ITPDAIAFVSILSACSHAGLLEEGRHFYELMTKEYKIVPRLEHFACMIDLL 447 Query: 70 GRAGHIVEAYNFIKKMPIEPNE 5 GRAG + EAY+FIK+MP+EPNE Sbjct: 448 GRAGRVREAYDFIKQMPLEPNE 469 >ref|XP_003634110.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423756|ref|XP_010662611.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423758|ref|XP_010662613.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423760|ref|XP_010662614.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423762|ref|XP_010662615.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423764|ref|XP_010662616.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423766|ref|XP_010662617.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423768|ref|XP_010662618.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423770|ref|XP_010662619.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] gi|731423772|ref|XP_010662620.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Vitis vinifera] Length = 678 Score = 129 bits (325), Expect = 7e-28 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+MQ+ GL PD IAFVSVLSACSHAGLL EG+++F LM E +++PRIEHF CMVDLL Sbjct: 394 LFSRMQDLGLNPDSIAFVSVLSACSHAGLLDEGRYYFKLMTEECKIVPRIEHFVCMVDLL 453 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY FIK+MP+EPNER Sbjct: 454 GRAGQVDEAYGFIKQMPMEPNER 476 >emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] Length = 1740 Score = 129 bits (325), Expect = 7e-28 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+MQ+ GL PD IAFVSVLSACSHAGLL EG+++F LM E +++PRIEHF CMVDLL Sbjct: 1383 LFSRMQDLGLNPDSIAFVSVLSACSHAGLLDEGRYYFKLMTEECKIVPRIEHFVCMVDLL 1442 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY FIK+MP+EPNER Sbjct: 1443 GRAGQVDEAYGFIKQMPMEPNER 1465 >ref|XP_007219220.1| hypothetical protein PRUPE_ppa017678mg, partial [Prunus persica] gi|462415682|gb|EMJ20419.1| hypothetical protein PRUPE_ppa017678mg, partial [Prunus persica] Length = 640 Score = 129 bits (324), Expect = 9e-28 Identities = 59/83 (71%), Positives = 73/83 (87%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LF KMQ+SG+ PD IAFVSV++ACSHAGLL+EGQ++FNLM E ++ PRIEHFACMVDLL Sbjct: 356 LFRKMQDSGVSPDSIAFVSVMAACSHAGLLEEGQYYFNLMTKECRIEPRIEHFACMVDLL 415 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY+F+K+M +EPNER Sbjct: 416 GRAGRVDEAYSFVKQMSLEPNER 438 >ref|XP_009621680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Nicotiana tomentosiformis] Length = 677 Score = 129 bits (323), Expect = 1e-27 Identities = 58/83 (69%), Positives = 75/83 (90%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFSKM ESGL+PD IAFVSVLSACSHAGLL+EG++++ LM ++Y+++PR+EH+ACMVDL Sbjct: 393 LFSKMLESGLQPDSIAFVSVLSACSHAGLLQEGEYYYRLMTDKYKIVPRLEHYACMVDLK 452 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG I EAYN++K+MP+E NER Sbjct: 453 GRAGCISEAYNYVKQMPMEANER 475 >gb|KDO56163.1| hypothetical protein CISIN_1g008276mg [Citrus sinensis] Length = 571 Score = 129 bits (323), Expect = 1e-27 Identities = 59/83 (71%), Positives = 73/83 (87%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFSKM SGL PD IAFVSVLSACSHAGLL+EG+++F +M +Y+++PRIEHFAC+VDLL Sbjct: 387 LFSKMLMSGLCPDSIAFVSVLSACSHAGLLEEGRYYFKIMTEQYKLVPRIEHFACLVDLL 446 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY+ IK+MP+EPNER Sbjct: 447 GRAGKVEEAYDLIKQMPMEPNER 469 >ref|XP_010035686.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Eucalyptus grandis] gi|702490459|ref|XP_010035687.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Eucalyptus grandis] gi|702490462|ref|XP_010035688.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Eucalyptus grandis] gi|702490468|ref|XP_010035689.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Eucalyptus grandis] gi|702490471|ref|XP_010035690.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Eucalyptus grandis] gi|629080685|gb|KCW47130.1| hypothetical protein EUGRSUZ_K00937 [Eucalyptus grandis] Length = 688 Score = 129 bits (323), Expect = 1e-27 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 250 LFSKMQESGLKPDHIAFVSVLSACSHAGLLKEGQHFFNLMVNEYQMIPRIEHFACMVDLL 71 LFS+MQ SGL+PD IAFVSVLSACSH GLL EG+ +FNLM+ E+ + PR+EHF+CMVDLL Sbjct: 404 LFSRMQNSGLEPDSIAFVSVLSACSHTGLLDEGRRYFNLMIEEHGIEPRLEHFSCMVDLL 463 Query: 70 GRAGHIVEAYNFIKKMPIEPNER 2 GRAG + EAY I+KMPIEPNER Sbjct: 464 GRAGKVDEAYRLIQKMPIEPNER 486