BLASTX nr result
ID: Cinnamomum24_contig00028735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00028735 (353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275324.1| PREDICTED: DNA replication ATP-dependent hel... 57 2e-06 ref|XP_010275325.1| PREDICTED: DNA replication ATP-dependent hel... 57 2e-06 >ref|XP_010275324.1| PREDICTED: DNA replication ATP-dependent helicase/nuclease DNA2 isoform X1 [Nelumbo nucifera] Length = 1351 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 26/50 (52%), Positives = 31/50 (62%) Frame = -2 Query: 319 EGSTLQLRPPMLHNPNTCQSCHHLNICTVYHKGI*THWEEEAFLKPFRSH 170 + STLQ PPML +PNTC+SC HLN CT+YHK + E F SH Sbjct: 653 KASTLQQLPPMLQSPNTCRSCRHLNACTIYHKAHGGNRESSGLGDLFDSH 702 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 351 MCRNELTADILKA 313 M RNEL DILKA Sbjct: 642 MRRNELANDILKA 654 >ref|XP_010275325.1| PREDICTED: DNA replication ATP-dependent helicase/nuclease DNA2 isoform X2 [Nelumbo nucifera] Length = 1273 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 26/50 (52%), Positives = 31/50 (62%) Frame = -2 Query: 319 EGSTLQLRPPMLHNPNTCQSCHHLNICTVYHKGI*THWEEEAFLKPFRSH 170 + STLQ PPML +PNTC+SC HLN CT+YHK + E F SH Sbjct: 575 KASTLQQLPPMLQSPNTCRSCRHLNACTIYHKAHGGNRESSGLGDLFDSH 624 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 351 MCRNELTADILKA 313 M RNEL DILKA Sbjct: 564 MRRNELANDILKA 576