BLASTX nr result
ID: Cinnamomum24_contig00028553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00028553 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM96855.1| hypothetical protein AMTR_s00510p00011440 [Ambore... 122 8e-26 ref|YP_173475.1| hypothetical protein NitaMp138 [Nicotiana tabac... 86 1e-14 gb|ERN19600.1| hypothetical protein AMTR_s00062p00116830 [Ambore... 75 2e-11 ref|XP_002534597.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 ref|XP_002535265.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_002512610.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 gb|KJB06797.1| hypothetical protein B456_001G159900 [Gossypium r... 56 9e-06 >gb|ERM96855.1| hypothetical protein AMTR_s00510p00011440 [Amborella trichopoda] Length = 83 Score = 122 bits (307), Expect = 8e-26 Identities = 61/82 (74%), Positives = 68/82 (82%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERR 76 MDI ERLAQVGEEIQHV+NDLRD R LLRAFW HL P NPAVV DRMR +Q I+GLERR Sbjct: 1 MDIPERLAQVGEEIQHVKNDLRDHRFLLRAFWIHLHPANPAVVEDRMRKTDQRIRGLERR 60 Query: 75 LQMLRNEQQELLVQASSAGERQ 10 LQMLRNEQQEL+V+ G+R+ Sbjct: 61 LQMLRNEQQELIVRTIILGDRR 82 >ref|YP_173475.1| hypothetical protein NitaMp138 [Nicotiana tabacum] gi|56806640|dbj|BAD83541.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 131 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/82 (53%), Positives = 56/82 (68%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERR 76 +DI +RLA++ EIQ+VEN LR R++L F RHLR VNPA + RM A Q I+ LE R Sbjct: 49 LDIPQRLAEINVEIQNVENSLRKTRIMLNGFLRHLRSVNPAAIEARMEASRQRIRELEER 108 Query: 75 LQMLRNEQQELLVQASSAGERQ 10 LQ LR EQQ L+V+A G R+ Sbjct: 109 LQGLRQEQQALIVEAIFLGARE 130 >gb|ERN19600.1| hypothetical protein AMTR_s00062p00116830 [Amborella trichopoda] Length = 67 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/44 (84%), Positives = 37/44 (84%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVG 124 MDIAERLAQVGEEIQHVENDL DRR LLRAFW LR NP VVG Sbjct: 1 MDIAERLAQVGEEIQHVENDLHDRRFLLRAFWIQLRLANPVVVG 44 >ref|XP_002534597.1| conserved hypothetical protein [Ricinus communis] gi|223524949|gb|EEF27784.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/82 (42%), Positives = 56/82 (68%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERR 76 M RL+++ E+ H++N++++RR L F R++R +PA R+ A + I+ LERR Sbjct: 3 MAATNRLSEIDAEMGHLKNEIKERRRALNLFLRNVRARDPAEAERRIGAARENIRDLERR 62 Query: 75 LQMLRNEQQELLVQASSAGERQ 10 LQ+LR EQQEL+VQA + G+R+ Sbjct: 63 LQVLRKEQQELIVQAVNLGDRE 84 >ref|XP_002535265.1| conserved hypothetical protein [Ricinus communis] gi|223523606|gb|EEF27117.1| conserved hypothetical protein [Ricinus communis] Length = 98 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/76 (36%), Positives = 45/76 (59%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERR 76 MDIA RL Q+ +EI ++N+ ++R +L W H +N VG RM+ + I+ L+ R Sbjct: 1 MDIAGRLTQINQEILRIDNEKQEREQMLGLLWEHPPALNTEAVGRRMQQIRDRIRALKER 60 Query: 75 LQMLRNEQQELLVQAS 28 + L EQQ L+V+ + Sbjct: 61 KRALLQEQQSLIVEGA 76 >ref|XP_002512610.1| conserved hypothetical protein [Ricinus communis] gi|223548571|gb|EEF50062.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/80 (40%), Positives = 46/80 (57%) Frame = -3 Query: 249 IAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERRLQ 70 IA RL ++ +E++ VEN + L AFW HL ++P +V D M + Q I LE R + Sbjct: 4 IARRLERIHQEVEMVENVKLQKERRLGAFWEHLPALDPVLVRDHMLYLTQQITSLENRKR 63 Query: 69 MLRNEQQELLVQASSAGERQ 10 +L E+QEL+V A RQ Sbjct: 64 LLLEEEQELIVHAVILCHRQ 83 >gb|KJB06797.1| hypothetical protein B456_001G159900 [Gossypium raimondii] Length = 114 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/76 (38%), Positives = 47/76 (61%) Frame = -3 Query: 255 MDIAERLAQVGEEIQHVENDLRDRRVLLRAFWRHLRPVNPAVVGDRMRAMEQGIKGLERR 76 MD A RL+ + E+ ++N++++ R +L R +R ++PA R+RA + I+GLE R Sbjct: 33 MDAANRLSAIAAEMGQLQNEIQEHRRVLNFLLRSVRTMDPARKEARIRATRERIEGLEER 92 Query: 75 LQMLRNEQQELLVQAS 28 Q LR EQQ L+V + Sbjct: 93 QQALRAEQQALIVHGA 108