BLASTX nr result
ID: Cinnamomum24_contig00028548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00028548 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828752.1| PREDICTED: 60S ribosomal protein L23A [Ambor... 70 8e-10 ref|XP_008803853.1| PREDICTED: 60S ribosomal protein L23A [Phoen... 69 2e-09 ref|XP_010940308.1| PREDICTED: 60S ribosomal protein L23A-like i... 68 2e-09 ref|XP_010940307.1| PREDICTED: 60S ribosomal protein L23A-like i... 68 2e-09 ref|XP_010935472.1| PREDICTED: 60S ribosomal protein L23A [Elaei... 68 2e-09 ref|XP_010669821.1| PREDICTED: 60S ribosomal protein L23A [Beta ... 67 4e-09 ref|XP_010042451.1| PREDICTED: 60S ribosomal protein L23a-like [... 67 4e-09 ref|XP_010067364.1| PREDICTED: 60S ribosomal protein L23a [Eucal... 67 4e-09 ref|XP_002284445.1| PREDICTED: 60S ribosomal protein L23a [Vitis... 67 4e-09 ref|XP_006847938.1| PREDICTED: 60S ribosomal protein L23A [Ambor... 67 4e-09 emb|CAA63107.1| ribosomal protein L23 [Spinacia oleracea] gi|902... 67 4e-09 sp|O22644.1|RL23A_FRIAG RecName: Full=60S ribosomal protein L23A... 67 5e-09 ref|XP_010907834.1| PREDICTED: 60S ribosomal protein L23A-like [... 67 5e-09 ref|XP_010067365.1| PREDICTED: 60S ribosomal protein L23a-1-like... 67 5e-09 ref|XP_008797929.1| PREDICTED: 60S ribosomal protein L23A-like [... 67 5e-09 ref|XP_008813252.1| PREDICTED: 60S ribosomal protein L23A-like [... 67 5e-09 ref|XP_010242311.1| PREDICTED: 60S ribosomal protein L23A [Nelum... 66 9e-09 ref|XP_002278186.1| PREDICTED: 60S ribosomal protein L23a-like [... 65 2e-08 ref|XP_009398435.1| PREDICTED: 60S ribosomal protein L23A-like [... 65 3e-08 ref|XP_010260042.1| PREDICTED: 60S ribosomal protein L23A [Nelum... 64 3e-08 >ref|XP_006828752.1| PREDICTED: 60S ribosomal protein L23A [Amborella trichopoda] gi|548833731|gb|ERM96168.1| hypothetical protein AMTR_s00001p00069970 [Amborella trichopoda] Length = 154 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGASTLKKK KKIRTSVTFHRPKT KKERNPKY Sbjct: 24 VKSGASTLKKKTKKIRTSVTFHRPKTLKKERNPKY 58 >ref|XP_008803853.1| PREDICTED: 60S ribosomal protein L23A [Phoenix dactylifera] Length = 155 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LK+KAKKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKRKAKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_010940308.1| PREDICTED: 60S ribosomal protein L23A-like isoform X2 [Elaeis guineensis] Length = 155 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LKKK KKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKKKTKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_010940307.1| PREDICTED: 60S ribosomal protein L23A-like isoform X1 [Elaeis guineensis] Length = 156 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LKKK KKIRTSVTFHRPKT KKERNPKY Sbjct: 26 VKSGASSLKKKTKKIRTSVTFHRPKTLKKERNPKY 60 >ref|XP_010935472.1| PREDICTED: 60S ribosomal protein L23A [Elaeis guineensis] Length = 155 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LKKK KKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKKKTKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_010669821.1| PREDICTED: 60S ribosomal protein L23A [Beta vulgaris subsp. vulgaris] gi|870866554|gb|KMT17513.1| hypothetical protein BVRB_2g037160 [Beta vulgaris subsp. vulgaris] Length = 154 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSG+STLKKKAKKIRT VTFHRPKT KK+RNPKY Sbjct: 24 VKSGSSTLKKKAKKIRTKVTFHRPKTLKKDRNPKY 58 >ref|XP_010042451.1| PREDICTED: 60S ribosomal protein L23a-like [Eucalyptus grandis] gi|702518506|ref|XP_010042452.1| PREDICTED: 60S ribosomal protein L23a-like [Eucalyptus grandis] Length = 155 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGA+T KKKAKKIRTSVTFHRP+T KKERNPKY Sbjct: 25 VKSGAATFKKKAKKIRTSVTFHRPRTLKKERNPKY 59 >ref|XP_010067364.1| PREDICTED: 60S ribosomal protein L23a [Eucalyptus grandis] gi|629099727|gb|KCW65492.1| hypothetical protein EUGRSUZ_G029021 [Eucalyptus grandis] gi|629099728|gb|KCW65493.1| hypothetical protein EUGRSUZ_G029021 [Eucalyptus grandis] Length = 155 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGA+T KKKAKKIRTSVTFHRP+T KKERNPKY Sbjct: 25 VKSGAATFKKKAKKIRTSVTFHRPRTLKKERNPKY 59 >ref|XP_002284445.1| PREDICTED: 60S ribosomal protein L23a [Vitis vinifera] gi|297746139|emb|CBI16195.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VK GAST KKKAKKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKLGASTFKKKAKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_006847938.1| PREDICTED: 60S ribosomal protein L23A [Amborella trichopoda] gi|769807525|ref|XP_011624675.1| PREDICTED: 60S ribosomal protein L23A [Amborella trichopoda] gi|548851243|gb|ERN09519.1| hypothetical protein AMTR_s00029p00132520 [Amborella trichopoda] Length = 155 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGASTLKKK KKIRTSVTFHRPKT KERNPKY Sbjct: 25 VKSGASTLKKKTKKIRTSVTFHRPKTLTKERNPKY 59 >emb|CAA63107.1| ribosomal protein L23 [Spinacia oleracea] gi|902236830|gb|KNA24560.1| hypothetical protein SOVF_014530 [Spinacia oleracea] Length = 155 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/36 (94%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = -3 Query: 106 VKSGASTLKKKA-KKIRTSVTFHRPKTFKKERNPKY 2 VKSGASTLKKKA KKIRT VTFHRPKTFKKERNPKY Sbjct: 24 VKSGASTLKKKASKKIRTKVTFHRPKTFKKERNPKY 59 >sp|O22644.1|RL23A_FRIAG RecName: Full=60S ribosomal protein L23A gi|2641201|gb|AAB86852.1| ribosomal protein L23a [Fritillaria agrestis] Length = 154 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSG STL+KKAKKIRTSVTFHRPKT KK+RNPKY Sbjct: 24 VKSGVSTLQKKAKKIRTSVTFHRPKTLKKDRNPKY 58 >ref|XP_010907834.1| PREDICTED: 60S ribosomal protein L23A-like [Elaeis guineensis] Length = 155 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LK+K KKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKRKTKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_010067365.1| PREDICTED: 60S ribosomal protein L23a-1-like [Eucalyptus grandis] Length = 133 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGA+T KKKAKK+RTSVTFHRP+T KKERNPKY Sbjct: 25 VKSGAATFKKKAKKVRTSVTFHRPRTLKKERNPKY 59 >ref|XP_008797929.1| PREDICTED: 60S ribosomal protein L23A-like [Phoenix dactylifera] Length = 155 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LKKK +KIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKKKTRKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_008813252.1| PREDICTED: 60S ribosomal protein L23A-like [Phoenix dactylifera] Length = 155 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS+LK+K KKIRTSVTFHRPKT KKERNPKY Sbjct: 25 VKSGASSLKRKTKKIRTSVTFHRPKTLKKERNPKY 59 >ref|XP_010242311.1| PREDICTED: 60S ribosomal protein L23A [Nelumbo nucifera] Length = 156 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS++KKK KKIRTSVTFHRPKT KK+RNPKY Sbjct: 26 VKSGASSIKKKTKKIRTSVTFHRPKTLKKDRNPKY 60 >ref|XP_002278186.1| PREDICTED: 60S ribosomal protein L23a-like [Vitis vinifera] Length = 155 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSG T KKKAKKIRTSVTFHRP+T KKERNPKY Sbjct: 25 VKSGGGTFKKKAKKIRTSVTFHRPRTLKKERNPKY 59 >ref|XP_009398435.1| PREDICTED: 60S ribosomal protein L23A-like [Musa acuminata subsp. malaccensis] gi|695022602|ref|XP_009398436.1| PREDICTED: 60S ribosomal protein L23A-like [Musa acuminata subsp. malaccensis] Length = 155 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSG++TLKKKAKKIRTSVTFHRPKT K RNPKY Sbjct: 25 VKSGSATLKKKAKKIRTSVTFHRPKTLSKARNPKY 59 >ref|XP_010260042.1| PREDICTED: 60S ribosomal protein L23A [Nelumbo nucifera] gi|720013039|ref|XP_010260043.1| PREDICTED: 60S ribosomal protein L23A [Nelumbo nucifera] Length = 156 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 106 VKSGASTLKKKAKKIRTSVTFHRPKTFKKERNPKY 2 VKSGAS++KKK KKIRTSVTFHRPKT KK+R+PKY Sbjct: 26 VKSGASSIKKKTKKIRTSVTFHRPKTLKKDRSPKY 60