BLASTX nr result
ID: Cinnamomum24_contig00027480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027480 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIG89840.1| hypothetical protein (mitochondrion) [Capsicum an... 67 3e-17 ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 78 2e-15 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 84 3e-14 gb|KJB09790.1| hypothetical protein B456_001G166300 [Gossypium r... 62 3e-12 emb|CDY67013.1| BnaUnng01800D [Brassica napus] 50 6e-12 ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 56 3e-10 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 67 7e-09 tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea m... 64 3e-08 ref|XP_013442825.1| NADH-quinone oxidoreductase protein [Medicag... 58 2e-06 >gb|AIG89840.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 131 Score = 67.0 bits (162), Expect(2) = 3e-17 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 80 HKGTRPFSYLNLKDRTLPYSRTLCRALPCPHF 175 HKG FSYLNLKDRTLPYSRTLCRALPCPHF Sbjct: 97 HKGLELFSYLNLKDRTLPYSRTLCRALPCPHF 128 Score = 48.1 bits (113), Expect(2) = 3e-17 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 1 VSGSNWFDLSQSSWPELVRSTCTE 72 VSGSNW +LSQSSWPELV STCTE Sbjct: 73 VSGSNWLNLSQSSWPELVCSTCTE 96 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 78.2 bits (191), Expect(2) = 2e-15 Identities = 39/65 (60%), Positives = 41/65 (63%) Frame = +2 Query: 167 PHFF*RGPKKCLHLLPTVFLRNYTERVDPPLPFVLATYPTVSSXXXXXXXXXXXXXCCGG 346 PHF + PKK LHLLPTVFL+N ERVDPP FVLATYP VSS CCGG Sbjct: 20 PHFLLKRPKKGLHLLPTVFLQNLIERVDPPPHFVLATYPKVSSLRVPRRRQKNQPVCCGG 79 Query: 347 AAFLF 361 A F F Sbjct: 80 ALFFF 84 Score = 30.4 bits (67), Expect(2) = 2e-15 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 114 LRTGPYPILEPSAELYPA 167 + GPYPILEPSA L PA Sbjct: 1 MHKGPYPILEPSAGLNPA 18 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 84.3 bits (207), Expect = 3e-14 Identities = 47/77 (61%), Positives = 52/77 (67%) Frame = -3 Query: 356 KKPPRHSRRVGSSVVAGELLARRP*DKLLKQTGGEDRPVQYNSEERLLAAGGDISLAPFK 177 K P HSRRVGSS+VAG+LL RRP LKQ G EDRPVQ N EERLLA GGD+SLA FK Sbjct: 37 KIAPHHSRRVGSSIVAGQLLVRRP--YFLKQKGEEDRPVQSNFEERLLAVGGDLSLALFK 94 Query: 176 RNAGRVELGRGFENRVG 126 R L +R+G Sbjct: 95 RKCRGAGLSSAEGSRIG 111 >gb|KJB09790.1| hypothetical protein B456_001G166300 [Gossypium raimondii] Length = 571 Score = 62.0 bits (149), Expect(2) = 3e-12 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 259 EGRIDPFSIIPKKDCWQQVETFLWPPSK 176 +GRIDPFSIIPKKDCW Q+ETFLWPPSK Sbjct: 210 DGRIDPFSIIPKKDCWLQMETFLWPPSK 237 Score = 35.8 bits (81), Expect(2) = 3e-12 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 185 PFKRNAGRVELGRGFENRV 129 P K NAGRV+LGRGFENRV Sbjct: 235 PSKGNAGRVKLGRGFENRV 253 >emb|CDY67013.1| BnaUnng01800D [Brassica napus] Length = 187 Score = 50.4 bits (119), Expect(2) = 6e-12 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 209 LPTVFLRNYTERVDPPLPFVLATYPTVSS 295 L TVFLRN TERVDP LPFVLATYP VSS Sbjct: 102 LSTVFLRNSTERVDPLLPFVLATYPKVSS 130 Score = 46.6 bits (109), Expect(2) = 6e-12 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +3 Query: 279 ILRSPRQELPGDDRGTNPPAVAGRLFCF 362 + + PRQEL GDDRGTNP AVAGRLF F Sbjct: 135 VTKVPRQELSGDDRGTNPLAVAGRLFLF 162 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 56.2 bits (134), Expect(2) = 3e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 264 NGRGGSTRSV*FRRKTVGSRWRHFFGPLQKK 172 +G GGSTRSV FRRKTVGSRWR FFGPLQK+ Sbjct: 36 DGGGGSTRSVKFRRKTVGSRWRPFFGPLQKE 66 Score = 35.0 bits (79), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -3 Query: 179 KRNAGR-VELGRGFENRVGSCP 117 K GR V+LGRGFENRVGSCP Sbjct: 65 KEMRGRGVKLGRGFENRVGSCP 86 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 273 QLILRSPRQELPGDDRGTNPPAVAGRLFCF 362 QLILRSPRQELPGDDRGTNPPAVAGRLFCF Sbjct: 135 QLILRSPRQELPGDDRGTNPPAVAGRLFCF 164 >tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea mays] Length = 88 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 259 EGRIDPFSIIPKKDCWQQVETFLWPPSK 176 EGRIDPFS IPKKDCWQQVETFLWPPSK Sbjct: 61 EGRIDPFSRIPKKDCWQQVETFLWPPSK 88 >ref|XP_013442825.1| NADH-quinone oxidoreductase protein [Medicago truncatula] gi|657370789|gb|KEH16850.1| NADH-quinone oxidoreductase protein [Medicago truncatula] Length = 556 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GGSTRSV*FRRKTVGSRWRHFFGPLQKK 172 GGSTRSV FRRKTVGSRWRHFFGPL+KK Sbjct: 243 GGSTRSVEFRRKTVGSRWRHFFGPLKKK 270