BLASTX nr result
ID: Cinnamomum24_contig00027456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027456 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16890.3| unnamed protein product [Vitis vinifera] 80 8e-13 ref|XP_010660523.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] 79 1e-12 ref|XP_010935587.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_008802748.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_010248809.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_010248801.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_006848652.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 1e-09 gb|ERN10234.1| hypothetical protein AMTR_s00171p00059960 [Ambore... 69 1e-09 ref|XP_012852219.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_010675446.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_009789586.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_011099085.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_009340504.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_009338086.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prun... 64 3e-08 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 64 4e-08 ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_009603085.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 >emb|CBI16890.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/76 (47%), Positives = 53/76 (69%) Frame = -2 Query: 244 DFHSKSFVYMANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLS 65 +F + + MA+L+ + ETQL +I C IV+KG+WN L K + S LT +I++ +L+ LS Sbjct: 17 NFQAFTSTAMASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLS 76 Query: 64 VDNCSLSWAFFKWAES 17 +D C +SWAFFKW ES Sbjct: 77 LDGCCVSWAFFKWVES 92 >ref|XP_010660523.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] gi|731418022|ref|XP_010660524.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vitis vinifera] Length = 590 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/67 (52%), Positives = 49/67 (73%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA+L+ + ETQL +I C IV+KG+WN L K + S LT +I++ +L+ LS+D C +SWA Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWA 60 Query: 37 FFKWAES 17 FFKW ES Sbjct: 61 FFKWVES 67 >emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/67 (52%), Positives = 49/67 (73%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA+L+ + ETQL +I C IV+KG+WN L K + S LT +I++ +L+ LS+D C +SWA Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWA 60 Query: 37 FFKWAES 17 FFKW ES Sbjct: 61 FFKWVES 67 >ref|XP_010935587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Elaeis guineensis] Length = 589 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/70 (55%), Positives = 50/70 (71%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 M +L+ RK E ++ CAIVLKG+W+ LS T IS CLT S V+ IL+QLS D LSWA Sbjct: 1 MGSLVYRKNEVGFIQGVCAIVLKGSWSNLSNTHISHCLTTSNVNQILLQLSADT-PLSWA 59 Query: 37 FFKWAESLPH 8 FF+W +SLP+ Sbjct: 60 FFRWMQSLPY 69 >ref|XP_008802748.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Phoenix dactylifera] Length = 589 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/70 (54%), Positives = 47/70 (67%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 M +L+ RK E ++ CAIV KGNW+ LS T +S T S V+ IL+QLS D SLSW Sbjct: 1 MGSLIYRKKEVAFIQGVCAIVSKGNWSNLSNTNVSHGFTTSNVNQILLQLSADT-SLSWG 59 Query: 37 FFKWAESLPH 8 FFKW +SLPH Sbjct: 60 FFKWLQSLPH 69 >ref|XP_010248809.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 isoform X2 [Nelumbo nucifera] Length = 455 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/70 (48%), Positives = 49/70 (70%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA + +++ E + + CA+++KGNW L K ++S C TPS+V+ IL+ LS+D L WA Sbjct: 1 MAFVTSQRNENKFAQSVCAVLMKGNWLNLLKPKMSHCFTPSLVNRILLYLSLDG-PLCWA 59 Query: 37 FFKWAESLPH 8 FFKW ESLPH Sbjct: 60 FFKWVESLPH 69 >ref|XP_010248801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 isoform X1 [Nelumbo nucifera] Length = 583 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/70 (48%), Positives = 49/70 (70%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA + +++ E + + CA+++KGNW L K ++S C TPS+V+ IL+ LS+D L WA Sbjct: 1 MAFVTSQRNENKFAQSVCAVLMKGNWLNLLKPKMSHCFTPSLVNRILLYLSLDG-PLCWA 59 Query: 37 FFKWAESLPH 8 FFKW ESLPH Sbjct: 60 FFKWVESLPH 69 >ref|XP_006848652.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g38730 [Amborella trichopoda] Length = 595 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/70 (47%), Positives = 49/70 (70%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA L+ K ET +R C I+LKG ++VL++ I+S T ++V+SIL LS D+ + SW+ Sbjct: 1 MAGLMAHKQETDFIRKVCGIILKGQFHVLTRPNITSRFTNTMVNSILSNLSSDSLA-SWS 59 Query: 37 FFKWAESLPH 8 FFKW ES+P+ Sbjct: 60 FFKWVESIPN 69 >gb|ERN10234.1| hypothetical protein AMTR_s00171p00059960 [Amborella trichopoda] Length = 261 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/70 (47%), Positives = 49/70 (70%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA L+ K ET +R C I+LKG ++VL++ I+S T ++V+SIL LS D+ + SW+ Sbjct: 1 MAGLMAHKQETDFIRKVCGIILKGQFHVLTRPNITSRFTNTMVNSILSNLSSDSLA-SWS 59 Query: 37 FFKWAESLPH 8 FFKW ES+P+ Sbjct: 60 FFKWVESIPN 69 >ref|XP_012852219.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Erythranthe guttatus] Length = 586 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/69 (40%), Positives = 47/69 (68%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 M L++ E +LV+ CA+V+KG W+ L K +I S +T S+++ L+ LS + S+SW+ Sbjct: 1 MEGLISASGERRLVKAVCAVVIKGYWDKLLKPKIGSLVTSSVMNQSLLDLSPYSVSISWS 60 Query: 37 FFKWAESLP 11 FFKW +++P Sbjct: 61 FFKWVDTIP 69 >ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Prunus mume] Length = 589 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNC--SLS 44 MA L++ ETQ ++ CA+V+KG WN + K +I S L+ + + +L+QLS+ S S Sbjct: 1 MAVLVSLTGETQFIQSLCAVVVKGQWNNILKPKIGSSLSSANIHQVLLQLSLHGYGPSPS 60 Query: 43 WAFFKWAESLP 11 WAFFKW ES+P Sbjct: 61 WAFFKWVESIP 71 >ref|XP_010675446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Beta vulgaris subsp. vulgaris] gi|870861830|gb|KMT13089.1| hypothetical protein BVRB_4g086300 [Beta vulgaris subsp. vulgaris] Length = 586 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/69 (46%), Positives = 45/69 (65%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 M+NL + E + ++ CAIVLKGNWN L K QI S L+ V+ +L QLS+D + SW Sbjct: 1 MSNLASISRENKSIKTLCAIVLKGNWNQLLKPQIGSHLSSVTVEKVLSQLSLDFYN-SWV 59 Query: 37 FFKWAESLP 11 F++W E +P Sbjct: 60 FYEWVEKIP 68 >ref|XP_009789586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Nicotiana sylvestris] Length = 590 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/70 (44%), Positives = 45/70 (64%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MANL E+++V+ A VLKGNW+ L K +I S +T + + L+ +S S SW+ Sbjct: 1 MANLFYANVESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTTISQALLDISQYCFSRSWS 60 Query: 37 FFKWAESLPH 8 FFKWAES+P+ Sbjct: 61 FFKWAESVPN 70 >ref|XP_011099085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Sesamum indicum] gi|747101884|ref|XP_011099086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Sesamum indicum] Length = 588 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/70 (45%), Positives = 44/70 (62%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 M +L E QLVR CAIV+KG W L K +I S +T S+++ L+ LS S+S + Sbjct: 1 MGSLNFASSERQLVRTVCAIVVKGYWVKLLKPKIGSLVTSSVMNQALLNLSPYEFSISLS 60 Query: 37 FFKWAESLPH 8 FFKW E++PH Sbjct: 61 FFKWVETIPH 70 >ref|XP_009340504.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Pyrus x bretschneideri] Length = 585 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSL--S 44 MA L++ ETQ + CAIV+KG W+ L K S L+ + + +L+QLS L S Sbjct: 1 MAALISLTGETQFIHSVCAIVVKGQWSNLLKPNNDSLLSSATIHQVLLQLSFHGYGLSPS 60 Query: 43 WAFFKWAESLP 11 WAFFKW ESLP Sbjct: 61 WAFFKWVESLP 71 >ref|XP_009338086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Pyrus x bretschneideri] Length = 585 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSL--S 44 MA L++ ETQ + CAIV+KG W+ L K S L+ + + +L+QLS L S Sbjct: 1 MAALISLTGETQFIHSVCAIVVKGQWSKLLKPNNHSLLSSATIHQVLLQLSFHGYGLSPS 60 Query: 43 WAFFKWAESLP 11 WAFFKW ESLP Sbjct: 61 WAFFKWVESLP 71 >ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] gi|462403897|gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] Length = 589 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNC--SLS 44 MA L++ ETQ + CA+V+KG+WN + K +I S L+ + + +L+QLS+ S S Sbjct: 1 MAVLVSLTGETQFIHSLCAVVVKGHWNNILKPKIGSSLSSANIHQVLLQLSLHGYGPSPS 60 Query: 43 WAFFKWAESLP 11 WAFFKW +S+P Sbjct: 61 WAFFKWVQSIP 71 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 63.9 bits (154), Expect = 4e-08 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCS--LS 44 MA ++T + ETQLV+ CA V+KG WN L + +I S LT S + +L QLS+ + LS Sbjct: 1 MAAVVTLRSETQLVQNICATVIKGGWNNLLRPKICSILTASTLHQVLYQLSLHSQGPCLS 60 Query: 43 WAFFKWAES 17 WA FKW ES Sbjct: 61 WALFKWIES 69 >ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Fragaria vesca subsp. vesca] Length = 589 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 2/63 (3%) Frame = -2 Query: 190 ETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNC--SLSWAFFKWAES 17 ETQL++ AIVLKG+W+ L ++ SCLT S + +L+QLS+ SLS +FFKWAES Sbjct: 10 ETQLIQSLFAIVLKGHWSHLLNPKLGSCLTSSAIHQVLLQLSLYGYTPSLSLSFFKWAES 69 Query: 16 LPH 8 LP+ Sbjct: 70 LPN 72 >ref|XP_009603085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Nicotiana tomentosiformis] Length = 590 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = -2 Query: 217 MANLLTRKPETQLVRIACAIVLKGNWNVLSKTQISSCLTPSIVDSILIQLSVDNCSLSWA 38 MA+L+ E+++V+ A VLKGNW+ L K +I S +T + + L+ +S S SW+ Sbjct: 1 MASLVRANVESEMVKAVAAAVLKGNWDNLLKPKIGSFVTSTTISQALLDISQYCFSRSWS 60 Query: 37 FFKWAESLPH 8 FFKWAES+P+ Sbjct: 61 FFKWAESVPN 70