BLASTX nr result
ID: Cinnamomum24_contig00027106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027106 (489 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510452.1| pentatricopeptide repeat-containing protein,... 69 2e-09 ref|XP_012071943.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_008221342.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_007226562.1| hypothetical protein PRUPE_ppa024458mg [Prun... 60 6e-07 ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128... 59 1e-06 ref|XP_009335755.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008387999.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfam... 58 3e-06 ref|XP_003615696.1| PPR containing plant-like protein [Medicago ... 57 7e-06 >ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551153|gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1218 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/77 (45%), Positives = 52/77 (67%) Frame = -3 Query: 232 PMASKTTLPSLPNKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTA 53 P+ K+ + S+PN+Q+T + F + P K S T KITD +L +LC+ G+L EAV+A Sbjct: 7 PIIKKSPI-SIPNEQDTLSAFSTKPTKSSVPFTK----KITDSHLNYLCKKGRLNEAVSA 61 Query: 52 INLLAESGSKVRPKTYI 2 + L+A+ GSKV PKT+I Sbjct: 62 LELIAQHGSKVSPKTFI 78 >ref|XP_012071943.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Jatropha curcas] Length = 889 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/65 (49%), Positives = 44/65 (67%) Frame = -3 Query: 196 NKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTAINLLAESGSKVR 17 NKQ+TP+ S P K S T + KI+D +L +LC+NG+L EAVTA+ +A+ G KVR Sbjct: 18 NKQDTPSICSSKPAKSSVPFTKKLHCKISDSHLNYLCQNGRLSEAVTALESIAQHGFKVR 77 Query: 16 PKTYI 2 KT+I Sbjct: 78 SKTFI 82 >ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nelumbo nucifera] Length = 898 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 169 PSNPN-KESTELTSEKPPKITDQYLLHLCRNGQLKEAVTAINLLAESGSKVRPKTYI 2 PS P+ K ++ SE P+IT+ +L HLCRNGQLKEAV+A++ +A+ GSKV PKTYI Sbjct: 33 PSIPSSKVPKKVASETAPRITEFHLNHLCRNGQLKEAVSALDSIAKRGSKVGPKTYI 89 >ref|XP_008221342.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Prunus mume] Length = 889 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/77 (37%), Positives = 44/77 (57%) Frame = -3 Query: 232 PMASKTTLPSLPNKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTA 53 P S P LP+K P++F K + + PK TD +L +LC+NG+ EA+T Sbjct: 7 PCKSSPPTPILPSKLGNPSEFSLRHAKPIISFSRKTLPKFTDTHLNYLCKNGRFSEAITV 66 Query: 52 INLLAESGSKVRPKTYI 2 ++ +A+ GSKV P TY+ Sbjct: 67 LDSIAQIGSKVPPTTYM 83 >ref|XP_007226562.1| hypothetical protein PRUPE_ppa024458mg [Prunus persica] gi|462423498|gb|EMJ27761.1| hypothetical protein PRUPE_ppa024458mg [Prunus persica] Length = 568 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/77 (37%), Positives = 43/77 (55%) Frame = -3 Query: 232 PMASKTTLPSLPNKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTA 53 P S P LP+K P++F K + + PK TD +L +LC+NGQ EA+T Sbjct: 7 PCKSSPPTPILPSKLGNPSEFSLRHAKPIISFSRKTLPKFTDTHLNYLCKNGQFSEAITV 66 Query: 52 INLLAESGSKVRPKTYI 2 ++ +A+ G KV P TY+ Sbjct: 67 LDSIAQIGYKVPPTTYM 83 >ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus euphratica] Length = 1277 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -3 Query: 196 NKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTAINLLAESGSKVR 17 +KQE+ ++F P K S PK D +L LC+NG L +AVT ++ +A+ GSKV Sbjct: 19 SKQESLSEFSQKPIKSSISFAKNPLPKFIDSHLDSLCKNGSLNDAVTVLDSVAQQGSKVT 78 Query: 16 PKTYI 2 P+TY+ Sbjct: 79 PRTYM 83 >ref|XP_009335755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Pyrus x bretschneideri] Length = 862 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/77 (36%), Positives = 46/77 (59%) Frame = -3 Query: 232 PMASKTTLPSLPNKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTA 53 P S + +P +P+K P++F K + + + PK TD +L +L +NG+ EAVT Sbjct: 7 PCKSSSPIPMVPSKFSNPSKFLPRQTKPTMSFSRKTLPKFTDSHLNYLRKNGEFTEAVTV 66 Query: 52 INLLAESGSKVRPKTYI 2 ++ +A+SGSKV TY+ Sbjct: 67 LDSIAKSGSKVTSTTYM 83 >ref|XP_008387999.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Malus domestica] Length = 851 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/77 (36%), Positives = 45/77 (58%) Frame = -3 Query: 232 PMASKTTLPSLPNKQETPAQFPSNPNKESTELTSEKPPKITDQYLLHLCRNGQLKEAVTA 53 P S +P +P+K P++F K + + + PK TD +L +L +NG+ EAVT Sbjct: 7 PCKSSPPIPIVPSKFSNPSEFLPRQTKPTISFSRKTLPKFTDSHLNYLRKNGEFTEAVTV 66 Query: 52 INLLAESGSKVRPKTYI 2 ++ +A+SGSKV TY+ Sbjct: 67 LDSIAKSGSKVTSTTYM 83 >ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590593723|ref|XP_007017650.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722977|gb|EOY14874.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722978|gb|EOY14875.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 890 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -3 Query: 202 LPNKQETPAQFPSNPNKESTELTSE-KPPKITDQYLLHLCRNGQLKEAVTAINLLAESGS 26 +P K E ++F P K + T + PKI+D +L +L RNG+L EA+TA++ +A+SGS Sbjct: 16 IPTKHENLSEFSQTPTKLAFSNTKKTNNPKISDSHLNYLSRNGRLTEAITALDSIAQSGS 75 Query: 25 KVRPKTYI 2 +VR T+I Sbjct: 76 QVRANTFI 83 >ref|XP_003615696.1| PPR containing plant-like protein [Medicago truncatula] gi|355517031|gb|AES98654.1| PPR containing plant-like protein [Medicago truncatula] Length = 887 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 13/80 (16%) Frame = -3 Query: 202 LPNKQETPAQFPSNPNK-----------ESTELTSEKPP--KITDQYLLHLCRNGQLKEA 62 +PNK TP FP+ P K S +++ KP K+ D L LC NG L EA Sbjct: 8 IPNKSITPLSFPNKPTKFDCISSKRVNANSNNVSTTKPSIRKLIDSQLNQLCINGSLSEA 67 Query: 61 VTAINLLAESGSKVRPKTYI 2 VT ++ LAE G +V+P TY+ Sbjct: 68 VTILDSLAEQGCRVKPITYM 87