BLASTX nr result
ID: Cinnamomum24_contig00027086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027086 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009177640.1| ribosomal protein L10 (mitochondrion) [Gossy... 89 1e-15 gb|ALJ78536.1| ribosomal protein L10 (mitochondrion) [Malus hupe... 88 3e-15 ref|YP_009153922.1| ribosomal protein L10 (mitochondrion) [Gossy... 88 3e-15 gb|KJB09772.1| hypothetical protein B456_001G163900 [Gossypium r... 88 3e-15 ref|YP_007905732.1| ribosomal protein L10 (mitochondrion) [Lirio... 87 4e-15 ref|YP_008999559.1| ribosomal protein L10 (mitochondrion) (mitoc... 86 1e-14 ref|YP_009041180.1| ribosomal protein subunit L10 (mitochondrion... 85 2e-14 ref|YP_008992403.1| ribosomal protein L10 (mitochondrion) [Salvi... 84 3e-14 gb|AHJ80993.1| ribosomal protein L10 (mitochondrion) [Panax gins... 83 7e-14 gb|ACZ52183.1| ribosomal protein L10 (mitochondrion) [Digitalis ... 82 1e-13 ref|YP_008802497.1| ribosomal protein subunit 10 (mitochondrion)... 82 1e-13 ref|YP_006280935.1| ribosomal protein L10 (mitochondrion) [Spiro... 82 2e-13 ref|YP_009045745.1| ribosomal protein L10 (mitochondrion) [Batis... 81 3e-13 ref|YP_008999591.1| ribosomal protein L10 (mitochondrion) [Vacci... 81 3e-13 ref|YP_009178746.1| ribosomal protein L10 (mitochondrion) [Popul... 79 1e-12 ref|YP_009173849.1| ribosomal protein L10 (mitochondrion) [Popul... 79 1e-12 gb|ACZ52191.1| ribosomal protein L10, partial (mitochondrion) [A... 78 3e-12 gb|ACZ52190.1| ribosomal protein L10, partial (mitochondrion) [P... 77 5e-12 ref|YP_173484.1| hypothetical protein NitaMp147 [Nicotiana tabac... 75 2e-11 ref|YP_006291832.1| ribosomal protein L10 (mitochondrion) [Daucu... 75 2e-11 >ref|YP_009177640.1| ribosomal protein L10 (mitochondrion) [Gossypium barbadense] gi|397911871|gb|AFO69203.1| ribosomal protein L10 (mitochondrion) [Gossypium hirsutum] gi|887515763|gb|AKQ51135.1| ribosomal protein L10 (mitochondrion) [Gossypium barbadense] Length = 162 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKASD +E ETS FHF+LPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 118 MDVEKASDFDEFETSLFHFYLPSSYLCFVCSREEFDLFNLGIPPK 162 >gb|ALJ78536.1| ribosomal protein L10 (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 162 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKA D +E+ETS FHF+LPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 118 MDVEKAYDFDEMETSLFHFYLPSSYLCFVCSREEFDLFNLGIPPK 162 >ref|YP_009153922.1| ribosomal protein L10 (mitochondrion) [Gossypium hirsutum] gi|849123260|ref|YP_009153956.1| ribosomal protein L10 (mitochondrion) [Gossypium harknessii] gi|430728003|gb|AGA54160.1| ribosomal protein L10 (mitochondrion) [Gossypium hirsutum] gi|430728038|gb|AGA54194.1| ribosomal protein L10 (mitochondrion) [Gossypium harknessii] Length = 162 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDV+KASD +E ETS FHF+LPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 118 MDVKKASDFDEFETSLFHFYLPSSYLCFVCSREEFDLFNLGIPPK 162 >gb|KJB09772.1| hypothetical protein B456_001G163900 [Gossypium raimondii] Length = 213 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDV+KASD +E ETS FHF+LPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 169 MDVKKASDFDEFETSLFHFYLPSSYLCFVCSREEFDLFNLGIPPK 213 >ref|YP_007905732.1| ribosomal protein L10 (mitochondrion) [Liriodendron tulipifera] gi|480541937|gb|AGJ90430.1| ribosomal protein L10 (mitochondrion) [Liriodendron tulipifera] Length = 159 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKASDLEE TS FHFHLPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 117 MDVEKASDLEE--TSLFHFHLPSSYLCFVCSREEFDLFNLGIPPK 159 >ref|YP_008999559.1| ribosomal protein L10 (mitochondrion) (mitochondrion) [Helianthus annuus] gi|571031397|gb|AHF21042.1| ribosomal protein L10 (mitochondrion) [Helianthus annuus] Length = 162 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKAS +ELETS FHF+LPSSYLCFVCS EEFDLFNLGIPPK Sbjct: 118 MDVEKASHFDELETSLFHFYLPSSYLCFVCSPEEFDLFNLGIPPK 162 >ref|YP_009041180.1| ribosomal protein subunit L10 (mitochondrion) [Rhazya stricta] gi|645929304|gb|AIB08827.1| ribosomal protein subunit L10 (mitochondrion) [Rhazya stricta] Length = 162 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKA +L+ELETSFFHF+LPSSYLCFVCSREE LFNLGIPPK Sbjct: 118 MDVEKAYNLDELETSFFHFYLPSSYLCFVCSREELYLFNLGIPPK 162 >ref|YP_008992403.1| ribosomal protein L10 (mitochondrion) [Salvia miltiorrhiza] gi|534292372|gb|AGU16664.1| ribosomal protein L10 (mitochondrion) [Salvia miltiorrhiza] Length = 162 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKAS +ELETS FHF+LPSSYL FVCSREEFDLFNLGIPPK Sbjct: 118 MDVEKASHFDELETSLFHFYLPSSYLSFVCSREEFDLFNLGIPPK 162 >gb|AHJ80993.1| ribosomal protein L10 (mitochondrion) [Panax ginseng] gi|586829776|gb|AHJ81016.1| ribosomal protein L10 (mitochondrion) [Panax ginseng] Length = 162 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKA +ELETS F+F+LPSSYLCFVCSREEFDLFNLGIPPK Sbjct: 118 MDVEKAYHFDELETSLFNFYLPSSYLCFVCSREEFDLFNLGIPPK 162 >gb|ACZ52183.1| ribosomal protein L10 (mitochondrion) [Digitalis purpurea] Length = 162 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKAS L+ELETS FHF+LPSSYL FVCSREEFDLFNLGIP K Sbjct: 118 MDVEKASHLDELETSLFHFYLPSSYLSFVCSREEFDLFNLGIPHK 162 >ref|YP_008802497.1| ribosomal protein subunit 10 (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562336|gb|AGZ63032.1| ribosomal protein subunit 10 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 162 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKAS+L+ELET FFHF+LPSSYLCFVCSREE LFNL IPPK Sbjct: 118 MDVEKASNLDELETYFFHFYLPSSYLCFVCSREELYLFNLSIPPK 162 >ref|YP_006280935.1| ribosomal protein L10 (mitochondrion) [Spirodela polyrhiza] gi|385252636|gb|AFI54944.1| ribosomal protein L10 (mitochondrion) [Spirodela polyrhiza] Length = 157 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGI 190 MDVEKAS EELETS F+FHLPSSYLCFVCSREEFDLFNLGI Sbjct: 114 MDVEKASSFEELETSLFNFHLPSSYLCFVCSREEFDLFNLGI 155 >ref|YP_009045745.1| ribosomal protein L10 (mitochondrion) [Batis maritima] gi|655168519|gb|AIC83348.1| ribosomal protein L10 (mitochondrion) (mitochondrion) [Batis maritima] Length = 162 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKASD +ELETS FHF+LPSSYLCFVCSR EFDLFNL I PK Sbjct: 118 MDVEKASDFDELETSLFHFYLPSSYLCFVCSRGEFDLFNLRILPK 162 >ref|YP_008999591.1| ribosomal protein L10 (mitochondrion) [Vaccinium macrocarpon] gi|549531666|gb|AGX28805.1| ribosomal protein L10 (mitochondrion) [Vaccinium macrocarpon] Length = 163 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MD+EKAS +ELETS FHF+LPSSYLCFVCS EEFDLFNLGIP K Sbjct: 119 MDLEKASHFDELETSLFHFYLPSSYLCFVCSGEEFDLFNLGIPSK 163 >ref|YP_009178746.1| ribosomal protein L10 (mitochondrion) [Populus tremula x Populus alba] gi|938485549|gb|ALJ49768.1| ribosomal protein L10 (mitochondrion) [Populus tremula x Populus alba] Length = 162 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKASD +ELETS FHF+LPSSYL FVCS E DLFNLGIPPK Sbjct: 118 MDVEKASDFDELETSLFHFYLPSSYLSFVCSGEGVDLFNLGIPPK 162 >ref|YP_009173849.1| ribosomal protein L10 (mitochondrion) [Populus tremula] gi|936227478|gb|ALH07312.1| ribosomal protein L10 (mitochondrion) [Populus tremula] Length = 162 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKASD +ELETS FHF+LPSSYL FVCS E DLFNLGIPPK Sbjct: 118 MDVEKASDFDELETSLFHFYLPSSYLSFVCSGEGVDLFNLGIPPK 162 >gb|ACZ52191.1| ribosomal protein L10, partial (mitochondrion) [Aristolochia elegans] Length = 146 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDL 205 MDVEKASD E+LETSFFHFHLPSSYLCFVCSREEFDL Sbjct: 110 MDVEKASDFEKLETSFFHFHLPSSYLCFVCSREEFDL 146 >gb|ACZ52190.1| ribosomal protein L10, partial (mitochondrion) [Persea sp. JPM015] Length = 146 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDL 205 MDVEKASD EELETS FHFHLPSSYLCFVCSREEFDL Sbjct: 110 MDVEKASDFEELETSLFHFHLPSSYLCFVCSREEFDL 146 >ref|YP_173484.1| hypothetical protein NitaMp147 [Nicotiana tabacum] gi|56806649|dbj|BAD83550.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] gi|756762093|gb|AJM70202.1| ribosomal protein L10 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 159 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEKAS+L+E+ETS FHF+LPSSYLCFVCS EEFD LGIPPK Sbjct: 118 MDVEKASNLDEIETSLFHFYLPSSYLCFVCSWEEFD---LGIPPK 159 >ref|YP_006291832.1| ribosomal protein L10 (mitochondrion) [Daucus carota subsp. sativus] gi|374081949|gb|AEY81141.1| ribosomal protein L10 (mitochondrion) [Daucus carota subsp. sativus] Length = 164 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 315 MDVEKASDLEELETSFFHFHLPSSYLCFVCSREEFDLFNLGIPPK 181 MDVEK +ELETS F+F+LPSSYLCFVCSREE +L NLGIPPK Sbjct: 120 MDVEKTYHFDELETSLFNFYLPSSYLCFVCSREELNLLNLGIPPK 164