BLASTX nr result
ID: Cinnamomum24_contig00026684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00026684 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251848.1| PREDICTED: cell division control protein 48 ... 56 9e-06 >ref|XP_010251848.1| PREDICTED: cell division control protein 48 homolog C [Nelumbo nucifera] Length = 826 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 237 GAVSTSEDAVFEEPVEPEFDLMKAMLRANYSNS 139 GAVSTSEDA++EE VEPEFDLMK+MLR++YS S Sbjct: 148 GAVSTSEDAIYEEKVEPEFDLMKSMLRSSYSAS 180