BLASTX nr result
ID: Cinnamomum24_contig00026641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00026641 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249098.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008465018.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008450449.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_004139110.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 gb|KQK21048.1| hypothetical protein BRADI_1g58370 [Brachypodium ... 116 6e-24 ref|XP_003557645.2| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_009795612.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 116 6e-24 ref|XP_009618113.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_010260127.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 116 8e-24 ref|XP_012843423.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_011078947.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 gb|EYU32342.1| hypothetical protein MIMGU_mgv1a019145mg [Erythra... 115 1e-23 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] 115 1e-23 ref|XP_011624686.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_011623547.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_009374255.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 >ref|XP_010249098.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Nelumbo nucifera] Length = 604 Score = 118 bits (295), Expect = 2e-24 Identities = 52/66 (78%), Positives = 56/66 (84%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ SP PIRV+KNLR C DCH A KLIS+IY REIIVRDRNRFHHFKDG C Sbjct: 539 KLAIAFGLISTSPRTPIRVMKNLRACGDCHLATKLISKIYSREIIVRDRNRFHHFKDGTC 598 Query: 210 SCNDYW 193 SCNDYW Sbjct: 599 SCNDYW 604 >ref|XP_008465018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 isoform X2 [Cucumis melo] Length = 734 Score = 118 bits (295), Expect = 2e-24 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ P PIR++KNLRVCR+CH+A KLIS+I++REII RDRNRFHHFKDG+C Sbjct: 669 KLAIAFGLISTKPGTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSC 728 Query: 210 SCNDYW 193 SCNDYW Sbjct: 729 SCNDYW 734 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Cucumis sativus] gi|700210212|gb|KGN65308.1| hypothetical protein Csa_1G306800 [Cucumis sativus] Length = 734 Score = 118 bits (295), Expect = 2e-24 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ P PIR++KNLRVCR+CH+A KLIS+I++REII RDRNRFHHFKDG+C Sbjct: 669 KLAIAFGLISTKPGTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSC 728 Query: 210 SCNDYW 193 SCNDYW Sbjct: 729 SCNDYW 734 >ref|XP_008450449.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis melo] Length = 609 Score = 117 bits (294), Expect = 3e-24 Identities = 50/66 (75%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ +P PIR+VKNLRVC DCH AIK IS++YDREIIVRDR R+HHFKDG C Sbjct: 544 KLAIAFGLMNTTPKTPIRIVKNLRVCNDCHLAIKFISKVYDREIIVRDRIRYHHFKDGTC 603 Query: 210 SCNDYW 193 SCNDYW Sbjct: 604 SCNDYW 609 >ref|XP_004139110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] gi|700211369|gb|KGN66465.1| hypothetical protein Csa_1G612890 [Cucumis sativus] Length = 609 Score = 117 bits (293), Expect = 3e-24 Identities = 50/66 (75%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ +P PIR+VKNLRVC DCH AIK IS++YDREIIVRDR R+HHFKDG C Sbjct: 544 KLAIAFGLMNTTPKTPIRIVKNLRVCSDCHLAIKFISKVYDREIIVRDRIRYHHFKDGTC 603 Query: 210 SCNDYW 193 SCNDYW Sbjct: 604 SCNDYW 609 >gb|KQK21048.1| hypothetical protein BRADI_1g58370 [Brachypodium distachyon] Length = 598 Score = 116 bits (291), Expect = 6e-24 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 +LA+AF LLK+ P PIR+VKNLRVC DCH AIKLIS++YDREIIVRDR+RFHHFK GAC Sbjct: 533 RLAIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGAC 592 Query: 210 SCNDYW 193 SC DYW Sbjct: 593 SCKDYW 598 >ref|XP_003557645.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Brachypodium distachyon] Length = 602 Score = 116 bits (291), Expect = 6e-24 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 +LA+AF LLK+ P PIR+VKNLRVC DCH AIKLIS++YDREIIVRDR+RFHHFK GAC Sbjct: 537 RLAIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGAC 596 Query: 210 SCNDYW 193 SC DYW Sbjct: 597 SCKDYW 602 >ref|XP_009795612.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana sylvestris] Length = 626 Score = 116 bits (291), Expect = 6e-24 Identities = 50/66 (75%), Positives = 56/66 (84%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGLLK P +R+ KNLRVC+DCH A KLIS++YDREIIVRDRNRFHHFKDG C Sbjct: 561 KLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDGEC 620 Query: 210 SCNDYW 193 SC DYW Sbjct: 621 SCKDYW 626 >ref|XP_009618113.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Nicotiana tomentosiformis] gi|697128126|ref|XP_009618114.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Nicotiana tomentosiformis] Length = 627 Score = 116 bits (291), Expect = 6e-24 Identities = 50/66 (75%), Positives = 56/66 (84%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGLLK P +R+ KNLRVC+DCH A KLIS++YDREIIVRDRNRFHHFKDG C Sbjct: 562 KLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDGEC 621 Query: 210 SCNDYW 193 SC DYW Sbjct: 622 SCKDYW 627 >ref|XP_010260127.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Nelumbo nucifera] Length = 651 Score = 116 bits (290), Expect = 8e-24 Identities = 50/66 (75%), Positives = 59/66 (89%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 +LA+AFGLLK S KPIRVVKNLRVCRDCH AIKL+S++Y REI++RD NRFHHF+DG C Sbjct: 586 RLAIAFGLLKLSTNKPIRVVKNLRVCRDCHLAIKLMSQVYGREIVLRDCNRFHHFRDGRC 645 Query: 210 SCNDYW 193 SCND+W Sbjct: 646 SCNDFW 651 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 116 bits (290), Expect = 8e-24 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGLL+ P +RV KNLRVCRDCH A KLIS +++REI+VRDRNRFHHF+DGAC Sbjct: 368 KLAIAFGLLRTRPGDTMRVTKNLRVCRDCHEATKLISRVFEREIVVRDRNRFHHFRDGAC 427 Query: 210 SCNDYW 193 SCNDYW Sbjct: 428 SCNDYW 433 >ref|XP_012843423.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Erythranthe guttatus] Length = 592 Score = 115 bits (289), Expect = 1e-23 Identities = 50/66 (75%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+K SP IR+VKNLRVC DCH+A KLIS IY R+I+VRDRNRFHHFKDG C Sbjct: 527 KLAIAFGLMKTSPGSTIRIVKNLRVCDDCHSATKLISVIYKRDIVVRDRNRFHHFKDGLC 586 Query: 210 SCNDYW 193 SCND+W Sbjct: 587 SCNDFW 592 >ref|XP_011078947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] gi|747064704|ref|XP_011078948.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] gi|747064706|ref|XP_011078949.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] gi|747064708|ref|XP_011078950.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] gi|747064710|ref|XP_011078951.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] gi|747064712|ref|XP_011078953.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] Length = 624 Score = 115 bits (289), Expect = 1e-23 Identities = 50/66 (75%), Positives = 56/66 (84%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGLLK P + IR+ KNLRVC+DCH A KLIS +Y+REIIVRDRNRFHHFK G C Sbjct: 559 KLAIAFGLLKTKPGETIRITKNLRVCKDCHQASKLISTVYNREIIVRDRNRFHHFKGGVC 618 Query: 210 SCNDYW 193 SCNDYW Sbjct: 619 SCNDYW 624 >gb|EYU32342.1| hypothetical protein MIMGU_mgv1a019145mg [Erythranthe guttata] Length = 486 Score = 115 bits (289), Expect = 1e-23 Identities = 50/66 (75%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+K SP IR+VKNLRVC DCH+A KLIS IY R+I+VRDRNRFHHFKDG C Sbjct: 421 KLAIAFGLMKTSPGSTIRIVKNLRVCDDCHSATKLISVIYKRDIVVRDRNRFHHFKDGLC 480 Query: 210 SCNDYW 193 SCND+W Sbjct: 481 SCNDFW 486 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 115 bits (289), Expect = 1e-23 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGLL+A P + +R+ KNLRVCRDCH A K++S ++DREI+VRDRNRFHHFKDG C Sbjct: 533 KLAIAFGLLRARPRETLRITKNLRVCRDCHEATKIVSRVFDREIVVRDRNRFHHFKDGTC 592 Query: 210 SCNDYW 193 SC DYW Sbjct: 593 SCKDYW 598 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Setaria italica] gi|944258175|gb|KQL22432.1| hypothetical protein SETIT_032871mg [Setaria italica] Length = 594 Score = 115 bits (289), Expect = 1e-23 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 +LA+AF LLK+ P PIR+VKNLRVC DCH AIKLIS+IYDREIIVRDR+RFHHFK G+C Sbjct: 529 RLAIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSC 588 Query: 210 SCNDYW 193 SC DYW Sbjct: 589 SCKDYW 594 >gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] Length = 588 Score = 115 bits (289), Expect = 1e-23 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+K+ P IR+ KNLRVC DCHAA KLIS++Y+REI+VRDRNRFHHFKDG C Sbjct: 523 KLAIAFGLMKSRPGATIRLSKNLRVCVDCHAATKLISKVYNREIVVRDRNRFHHFKDGLC 582 Query: 210 SCNDYW 193 SCNDYW Sbjct: 583 SCNDYW 588 >ref|XP_011624686.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 795 Score = 115 bits (288), Expect = 1e-23 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ +P PIR+VKNLRVC DCH+A KLIS+IY REIIVRDRNR+HHFK+G+C Sbjct: 730 KLAIAFGLISTAPCTPIRIVKNLRVCDDCHSATKLISKIYGREIIVRDRNRYHHFKEGSC 789 Query: 210 SCNDYW 193 SC DYW Sbjct: 790 SCRDYW 795 >ref|XP_011623547.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 604 Score = 115 bits (288), Expect = 1e-23 Identities = 51/66 (77%), Positives = 55/66 (83%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ SP IRVVKNLR C DCH A KLIS+IYDREIIVRDRNRFHHFKDG C Sbjct: 539 KLAIAFGLISTSPGSTIRVVKNLRACGDCHEATKLISKIYDREIIVRDRNRFHHFKDGTC 598 Query: 210 SCNDYW 193 SC D+W Sbjct: 599 SCRDFW 604 >ref|XP_009374255.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Pyrus x bretschneideri] Length = 738 Score = 115 bits (288), Expect = 1e-23 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -3 Query: 390 KLAVAFGLLKASPAKPIRVVKNLRVCRDCHAAIKLISEIYDREIIVRDRNRFHHFKDGAC 211 KLA+AFGL+ SP++PI+VVKNLRVC DCHA KLIS +YDREI++RDR RFHHF+DG C Sbjct: 673 KLAIAFGLISLSPSQPIQVVKNLRVCGDCHAVAKLISRVYDREILLRDRYRFHHFRDGHC 732 Query: 210 SCNDYW 193 SCNDYW Sbjct: 733 SCNDYW 738