BLASTX nr result
ID: Cinnamomum24_contig00026365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00026365 (534 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008390463.1| PREDICTED: putative ribonuclease H protein A... 50 2e-06 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 50 3e-06 ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 49 7e-06 ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 49 7e-06 ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prun... 49 8e-06 >ref|XP_008390463.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica] Length = 562 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 417 ISNIPIFYF-LFKCPVWVANCIEKL*HDFLWQGKDNKNKFHLVDWKST*KSK 265 + ++PI+Y LFK P WV +EKL FLW+G + K HLV W+ K+K Sbjct: 142 LGSLPIYYMSLFKIPCWVRGRLEKLMKGFLWEGVEEGKKTHLVKWELVTKNK 193 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 469 WNPVLERMERKLATWNTNF 413 W+PV+E MER+L +W F Sbjct: 110 WDPVVETMERRLQSWKKAF 128 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 50.1 bits (118), Expect(2) = 3e-06 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 417 ISNIPIFYF-LFKCPVWVANCIEKL*HDFLWQGKDNKNKFHLVDWKST*KSK 265 +S+IP +Y LFK P+ VA +E+L +FLW+G D K HLV W+ KSK Sbjct: 1092 LSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLDEGKKCHLVRWERVTKSK 1143 Score = 27.7 bits (60), Expect(2) = 3e-06 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 469 WNPVLERMERKLATW 425 WNPV+E++E++L W Sbjct: 1060 WNPVMEKVEKRLQKW 1074 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 48.5 bits (114), Expect(2) = 7e-06 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 417 ISNIPIFYF-LFKCPVWVANCIEKL*HDFLWQGKDNKNKFHLVDWKST*KSK 265 +S+IP +Y LFK P+ VA +E+L +FLW+G + K HLV W+ KSK Sbjct: 1043 LSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEEGKKCHLVRWERVTKSK 1094 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 469 WNPVLERMERKLATW 425 WNPV+E++E++L W Sbjct: 1011 WNPVMEKVEKRLQKW 1025 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 48.5 bits (114), Expect(2) = 7e-06 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 417 ISNIPIFYF-LFKCPVWVANCIEKL*HDFLWQGKDNKNKFHLVDWKST*KSK 265 +S+IP +Y LFK P+ VA +E+L +FLW+G + K HLV W+ KSK Sbjct: 536 LSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEEGKKCHLVRWERVTKSK 587 Score = 27.7 bits (60), Expect(2) = 7e-06 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 469 WNPVLERMERKLATW 425 WNPV+E++E++L W Sbjct: 504 WNPVMEKVEKRLQKW 518 >ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] gi|462421245|gb|EMJ25508.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] Length = 469 Score = 48.5 bits (114), Expect(2) = 8e-06 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 417 ISNIPIFYF-LFKCPVWVANCIEKL*HDFLWQGKDNKNKFHLVDWKST*KSK 265 +S+IP +Y LFK P+ VA +E+L +FLW+G + K HLV W+ KSK Sbjct: 50 LSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEEGKKCHLVRWERVTKSK 101 Score = 27.7 bits (60), Expect(2) = 8e-06 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -3 Query: 469 WNPVLERMERKLATW 425 WNPV+E++E++L W Sbjct: 18 WNPVMEKVEKRLQKW 32