BLASTX nr result
ID: Cinnamomum24_contig00026247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00026247 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935201.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_008781345.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 gb|ERM96287.1| hypothetical protein AMTR_s00001p00173820 [Ambore... 72 1e-10 ref|XP_010266067.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_004292639.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_007200730.1| hypothetical protein PRUPE_ppa021547mg [Prun... 70 6e-10 ref|XP_012570240.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_010086846.1| hypothetical protein L484_006076 [Morus nota... 68 2e-09 ref|XP_008358363.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008358358.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_003592666.1| pentatricopeptide (PPR) repeat protein [Medi... 67 5e-09 ref|XP_009408172.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_013736799.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_013736798.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_009136362.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_009136361.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 emb|CDY71477.1| BnaAnng37590D, partial [Brassica napus] 66 9e-09 ref|XP_010548124.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_008348830.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_013685182.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 >ref|XP_010935201.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Elaeis guineensis] Length = 434 Score = 76.6 bits (187), Expect = 7e-12 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 270 GESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 GESP+K +VSEMMFQ+NS ++IDR+NAGRFVARGKAV+DWLC Sbjct: 392 GESPVKMLVSEMMFQLNSSMRIDRKNAGRFVARGKAVRDWLC 433 >ref|XP_008781345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Phoenix dactylifera] Length = 427 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/42 (76%), Positives = 40/42 (95%) Frame = -2 Query: 270 GESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 GESP+K +VSEMMFQ+NS ++IDR+NAGRFVA+GKAV+DWLC Sbjct: 386 GESPVKMLVSEMMFQLNSSMRIDRKNAGRFVAQGKAVRDWLC 427 >gb|ERM96287.1| hypothetical protein AMTR_s00001p00173820 [Amborella trichopoda] Length = 432 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWL 148 S RGES +K +VSEMMFQM SPLK+DR N GRFVARGKAVK WL Sbjct: 388 SVRGESTVKKLVSEMMFQMGSPLKVDRLNVGRFVARGKAVKTWL 431 >ref|XP_010266067.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Nelumbo nucifera] Length = 451 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM +M SP+KIDR N G FV RGKAV+DWLC Sbjct: 401 SVRGESPVKALVKQMMVRMKSPMKIDRNNVGCFVGRGKAVRDWLC 445 >ref|XP_004292639.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Fragaria vesca subsp. vesca] Length = 448 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+K +V EMM QM SP++IDR+N G F+A+G+AVKDWLC Sbjct: 404 SVRGESPVKDLVKEMMHQMESPMRIDRKNVGCFIAKGRAVKDWLC 448 >ref|XP_007200730.1| hypothetical protein PRUPE_ppa021547mg [Prunus persica] gi|462396130|gb|EMJ01929.1| hypothetical protein PRUPE_ppa021547mg [Prunus persica] Length = 447 Score = 70.1 bits (170), Expect = 6e-10 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+K +V +MM +M SP++IDR+N G FVA+G+AVKDWLC Sbjct: 403 SVRGESPVKGLVKQMMLRMESPMRIDRKNVGCFVAKGRAVKDWLC 447 >ref|XP_012570240.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Cicer arietinum] Length = 502 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 + RGESP+K +V EM+ +M SPL+IDR+N G FVA+GKAVK+WLC Sbjct: 453 NVRGESPVKVLVKEMLMKMKSPLRIDRKNIGCFVAKGKAVKNWLC 497 >ref|XP_010086846.1| hypothetical protein L484_006076 [Morus notabilis] gi|587833217|gb|EXB24044.1| hypothetical protein L484_006076 [Morus notabilis] Length = 517 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 + RG SP+K +V EMM QM SP+KIDR+NAG F+A+GK V+DWLC Sbjct: 473 NVRGVSPVKILVKEMMVQMKSPMKIDRKNAGCFLAKGKTVRDWLC 517 >ref|XP_008358363.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like [Malus domestica] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+K +V MM +M SP++IDR+N G F+A+G+AVKDWLC Sbjct: 414 SVRGESPVKGLVKVMMHRMGSPMRIDRKNVGCFIAKGRAVKDWLC 458 >ref|XP_008358358.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like [Malus domestica] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+K +V MM +M SP++IDR+N G F+A+G+AVKDWLC Sbjct: 414 SVRGESPVKGLVKVMMHRMGSPMRIDRKNVGCFIAKGRAVKDWLC 458 >ref|XP_003592666.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355481714|gb|AES62917.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 454 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 + RGESP+K +V EMM +M PL+IDR+N G FVA+GKAVK WLC Sbjct: 405 NVRGESPVKVLVKEMMMKMKGPLRIDRKNTGCFVAKGKAVKIWLC 449 >ref|XP_009408172.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Musa acuminata subsp. malaccensis] Length = 430 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -2 Query: 273 RGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 RG SPIK +VSEMMF+ +SP++ID +N GRFVARGKAV +W+C Sbjct: 388 RGRSPIKDLVSEMMFRKSSPMRIDSKNPGRFVARGKAVWEWMC 430 >ref|XP_013736799.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like isoform X2 [Brassica napus] gi|923551606|ref|XP_013736800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like isoform X2 [Brassica napus] gi|923551608|ref|XP_013736801.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like isoform X2 [Brassica napus] gi|923551610|ref|XP_013736803.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like isoform X2 [Brassica napus] Length = 458 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 413 SVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 457 >ref|XP_013736798.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like isoform X1 [Brassica napus] Length = 461 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 416 SVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 460 >ref|XP_009136362.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 isoform X2 [Brassica rapa] gi|685290812|ref|XP_009136363.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 isoform X2 [Brassica rapa] gi|685290814|ref|XP_009136364.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 isoform X2 [Brassica rapa] Length = 458 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 413 SVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 457 >ref|XP_009136361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 isoform X1 [Brassica rapa] Length = 461 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 416 SVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 460 >emb|CDY71477.1| BnaAnng37590D, partial [Brassica napus] Length = 462 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 417 SVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 461 >ref|XP_010548124.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Tarenaya hassleriana] gi|729371006|ref|XP_010548125.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Tarenaya hassleriana] Length = 462 Score = 65.5 bits (158), Expect = 2e-08 Identities = 26/45 (57%), Positives = 38/45 (84%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 + RGESP+KA+V ++M + SP++IDR+N G F+A+GKAVK+WLC Sbjct: 417 NVRGESPVKALVKKIMVRTGSPMRIDRKNIGSFIAKGKAVKEWLC 461 >ref|XP_008348830.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like [Malus domestica] Length = 358 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 S GESP+K +V MM +M SP++IDR+N G F+A+G+AVKDWLC Sbjct: 311 SVXGESPVKGLVKVMMHRMGSPMRIDRKNVGCFIAKGRAVKDWLC 355 >ref|XP_013685182.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like [Brassica napus] gi|923793997|ref|XP_013685183.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033-like [Brassica napus] Length = 461 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -2 Query: 279 STRGESPIKAVVSEMMFQMNSPLKIDRRNAGRFVARGKAVKDWLC 145 + RGESP+KA+V +MM + SP++IDR+N G F+A+GK VK+WLC Sbjct: 416 TVRGESPVKALVKKMMVRTGSPMRIDRKNVGCFIAKGKTVKEWLC 460