BLASTX nr result
ID: Cinnamomum24_contig00026155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00026155 (343 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938733.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_009401187.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_008800270.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_010255813.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 emb|CDP12559.1| unnamed protein product [Coffea canephora] 67 7e-09 ref|XP_004515007.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_012569772.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 gb|KDO83244.1| hypothetical protein CISIN_1g006744mg [Citrus sin... 65 3e-08 ref|XP_006482966.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_006438906.1| hypothetical protein CICLE_v10030824mg [Citr... 65 3e-08 gb|KRH55198.1| hypothetical protein GLYMA_06G236700 [Glycine max] 64 3e-08 gb|KRG90809.1| hypothetical protein GLYMA_20G115000 [Glycine max] 64 3e-08 gb|KHN23162.1| Pentatricopeptide repeat-containing protein [Glyc... 64 3e-08 gb|KHN11425.1| Pentatricopeptide repeat-containing protein [Glyc... 64 3e-08 ref|XP_006605814.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_004511291.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_010106422.1| hypothetical protein L484_008628 [Morus nota... 63 8e-08 ref|XP_010645700.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_003598903.2| PPR containing plant-like protein [Medicago ... 63 8e-08 ref|XP_012069204.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 >ref|XP_010938733.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Elaeis guineensis] Length = 703 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKLT 208 +R +LSEAN ++YEELL +HLK +TAGLV+SGLKFFGLESKLKLT Sbjct: 655 DRKILSEANFIVYEELLNEHLKKITAGLVISGLKFFGLESKLKLT 699 >ref|XP_009401187.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Musa acuminata subsp. malaccensis] Length = 730 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKLTRSL 199 +RNLL+EAN ++YEELL +HLK TAGLV+SG+KFFGLESKL+ T +L Sbjct: 682 DRNLLTEANFIVYEELLNEHLKKTTAGLVISGMKFFGLESKLRWTSNL 729 >ref|XP_008800270.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740, partial [Phoenix dactylifera] Length = 654 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKLT 208 +R +LSE N ++YEELL +HLK +TAGLV+SGLKFFGLESKLKLT Sbjct: 606 DRKILSEVNFIVYEELLNEHLKKITAGLVVSGLKFFGLESKLKLT 650 >ref|XP_010255813.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Nelumbo nucifera] gi|719965226|ref|XP_010255821.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Nelumbo nucifera] Length = 733 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 +R+LL+EAN ++Y+E L+DH+K TAGLVLSGLKFFGLESKLK Sbjct: 682 DRSLLTEANMIVYDEFLIDHMKKKTAGLVLSGLKFFGLESKLK 724 >emb|CDP12559.1| unnamed protein product [Coffea canephora] Length = 727 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKLTRSLTPMPG 184 R LLSEA+ ++Y+ELL+DH+K TA LVLSGLKFFGLE KLK R T +PG Sbjct: 677 RQLLSEADVIVYDELLIDHMKKKTADLVLSGLKFFGLEKKLK-ARGSTLLPG 727 >ref|XP_004515007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 NR LL+E+++++Y+ELL+DH+K TA LV+SGLKFFGLESKLK Sbjct: 669 NRKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLK 711 >ref|XP_012569772.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302886|ref|XP_012569773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302888|ref|XP_012569774.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302890|ref|XP_012569775.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828302892|ref|XP_012569776.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKL 211 +R LL+E+++++Y+ELL+DH+K TA LV+SGLKFFGLESKLKL Sbjct: 669 DRKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLKL 712 >gb|KDO83244.1| hypothetical protein CISIN_1g006744mg [Citrus sinensis] Length = 632 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R LL+EAN+++Y+E+L++H+K TA LVLSGLKFFGLESKLK Sbjct: 582 RKLLTEANTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLK 623 >ref|XP_006482966.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Citrus sinensis] Length = 721 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R LL+EAN+++Y+E+L++H+K TA LVLSGLKFFGLESKLK Sbjct: 671 RKLLTEANTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLK 712 >ref|XP_006438906.1| hypothetical protein CICLE_v10030824mg [Citrus clementina] gi|557541102|gb|ESR52146.1| hypothetical protein CICLE_v10030824mg [Citrus clementina] Length = 721 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R LL+EAN+++Y+E+L++H+K TA LVLSGLKFFGLESKLK Sbjct: 671 RKLLTEANTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLK 712 >gb|KRH55198.1| hypothetical protein GLYMA_06G236700 [Glycine max] Length = 764 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 RN L+E+N+++Y+ELL+DH+K TA LVLS LKFFGLESKLK Sbjct: 714 RNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLK 755 >gb|KRG90809.1| hypothetical protein GLYMA_20G115000 [Glycine max] Length = 695 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 RN L+E+N+++Y+ELL+DH+K TA LVLS LKFFGLESKLK Sbjct: 645 RNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLK 686 >gb|KHN23162.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 680 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 RN L+E+N+++Y+ELL+DH+K TA LVLS LKFFGLESKLK Sbjct: 630 RNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLK 671 >gb|KHN11425.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 425 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 RN L+E+N+++Y+ELL+DH+K TA LVLS LKFFGLESKLK Sbjct: 375 RNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLK 416 >ref|XP_006605814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like isoform X2 [Glycine max] gi|571565751|ref|XP_003555182.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like isoform X1 [Glycine max] gi|947040805|gb|KRG90529.1| hypothetical protein GLYMA_20G097200 [Glycine max] gi|947040806|gb|KRG90530.1| hypothetical protein GLYMA_20G097200 [Glycine max] Length = 764 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 RN L+E+N+++Y+ELL+DH+K TA LVLS LKFFGLESKLK Sbjct: 714 RNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLK 755 >ref|XP_004511291.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330040|ref|XP_004511445.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330043|ref|XP_012574365.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330046|ref|XP_012574366.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330051|ref|XP_012574367.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] gi|828330054|ref|XP_012574368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/43 (65%), Positives = 39/43 (90%) Frame = -2 Query: 342 NRNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 +R LL+E+++++Y+ELL+DH+K TA LV+SGLKFFGLESKLK Sbjct: 669 DRKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLK 711 >ref|XP_010106422.1| hypothetical protein L484_008628 [Morus notabilis] gi|587923100|gb|EXC10461.1| hypothetical protein L484_008628 [Morus notabilis] Length = 716 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R L+SEA +++Y+E+L+DH+K TA LV+SGLKFFGLESKLK Sbjct: 666 RKLMSEARTIVYDEILIDHMKKKTADLVVSGLKFFGLESKLK 707 >ref|XP_010645700.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] gi|296081308|emb|CBI17752.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLKLTRSLTPMPG*VQPPGIS 160 R LL+EAN ++Y+E+L++H+K TA LVLSGLKFFGLESKL+ ++ T +P PG S Sbjct: 671 RKLLTEANVIVYDEILIEHMKKKTADLVLSGLKFFGLESKLR-SKGSTLLPIENSNPGSS 729 >ref|XP_003598903.2| PPR containing plant-like protein [Medicago truncatula] gi|657392061|gb|AES69154.2| PPR containing plant-like protein [Medicago truncatula] Length = 723 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R LL+E+++++Y+ELL+DH+K TA LV+SGLKFFGLESKLK Sbjct: 673 RKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLK 714 >ref|XP_012069204.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Jatropha curcas] Length = 1159 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -2 Query: 339 RNLLSEANSVLYEELLVDHLKTMTAGLVLSGLKFFGLESKLK 214 R LL+EA +++Y+E+L++H+K TA LVLSGLKFFGLESKLK Sbjct: 1109 RKLLTEAKTIVYDEILIEHMKKKTADLVLSGLKFFGLESKLK 1150