BLASTX nr result
ID: Cinnamomum24_contig00025992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025992 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858443.2| PREDICTED: uncharacterized protein LOC184483... 57 7e-06 gb|ERN19911.1| hypothetical protein AMTR_s00071p00081750 [Ambore... 57 7e-06 >ref|XP_006858443.2| PREDICTED: uncharacterized protein LOC18448311 [Amborella trichopoda] Length = 657 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = -3 Query: 161 EEFDLRSISFRMPDDGI-----ADDTQTIEDKCLWLRSQLIGADTCFDTPFGERRLTY 3 E+F S+SF P +G AD + KC+WLRSQLIG+ T DTPFG+R LTY Sbjct: 29 EDFRESSVSFETPKEGAYGIEGADGMDGADKKCVWLRSQLIGSSTEIDTPFGKRILTY 86 >gb|ERN19911.1| hypothetical protein AMTR_s00071p00081750 [Amborella trichopoda] Length = 118 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = -3 Query: 161 EEFDLRSISFRMPDDGI-----ADDTQTIEDKCLWLRSQLIGADTCFDTPFGERRLTY 3 E+F S+SF P +G AD + KC+WLRSQLIG+ T DTPFG+R LTY Sbjct: 29 EDFRESSVSFETPKEGAYGIEGADGMDGADKKCVWLRSQLIGSSTEIDTPFGKRILTY 86