BLASTX nr result
ID: Cinnamomum24_contig00025761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025761 (261 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010264955.1| PREDICTED: diphthine--ammonia ligase isoform... 74 5e-11 ref|XP_010264954.1| PREDICTED: diphthine--ammonia ligase isoform... 74 5e-11 ref|XP_010558738.1| PREDICTED: diphthine--ammonia ligase isoform... 73 9e-11 ref|XP_013627835.1| PREDICTED: diphthine--ammonia ligase-like [B... 72 1e-10 ref|XP_008810325.1| PREDICTED: diphthine--ammonia ligase isoform... 72 1e-10 ref|XP_008810317.1| PREDICTED: diphthine--ammonia ligase isoform... 72 1e-10 ref|XP_010102215.1| hypothetical protein L484_024496 [Morus nota... 72 2e-10 ref|XP_009419957.1| PREDICTED: diphthine--ammonia ligase isoform... 72 2e-10 ref|XP_009419955.1| PREDICTED: diphthine--ammonia ligase isoform... 72 2e-10 ref|XP_002521986.1| protein with unknown function [Ricinus commu... 72 2e-10 ref|XP_002325340.1| endoribonuclease L-PSP family protein [Popul... 72 2e-10 ref|XP_010463925.1| PREDICTED: diphthine--ammonia ligase-like [C... 72 2e-10 ref|XP_010415376.1| PREDICTED: diphthine--ammonia ligase-like [C... 72 2e-10 ref|XP_013450430.1| meiotically up-regulated protein 71-like pro... 72 2e-10 ref|XP_003626157.2| meiotically up-regulated protein 71-like pro... 72 2e-10 ref|XP_006297070.1| hypothetical protein CARUB_v10013071mg [Caps... 72 2e-10 ref|NP_187098.2| endoribonuclease [Arabidopsis thaliana] gi|3326... 72 2e-10 gb|AAF63779.1| unknown protein [Arabidopsis thaliana] 72 2e-10 ref|XP_011080568.1| PREDICTED: diphthine--ammonia ligase isoform... 71 3e-10 ref|XP_010043303.1| PREDICTED: diphthine--ammonia ligase [Eucaly... 71 3e-10 >ref|XP_010264955.1| PREDICTED: diphthine--ammonia ligase isoform X2 [Nelumbo nucifera] Length = 653 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVVGLVSGGKDSCYAMMKC+E+GHEIVALANLMP++ Sbjct: 1 MKVVGLVSGGKDSCYAMMKCMEYGHEIVALANLMPIE 37 >ref|XP_010264954.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Nelumbo nucifera] Length = 744 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVVGLVSGGKDSCYAMMKC+E+GHEIVALANLMP++ Sbjct: 1 MKVVGLVSGGKDSCYAMMKCMEYGHEIVALANLMPIE 37 >ref|XP_010558738.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Tarenaya hassleriana] Length = 729 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCIE+GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIEYGHEIVALANLLPVD 37 >ref|XP_013627835.1| PREDICTED: diphthine--ammonia ligase-like [Brassica oleracea var. oleracea] Length = 111 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCY MMKCI+HGHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYVMMKCIQHGHEIVALANLLPVD 37 >ref|XP_008810325.1| PREDICTED: diphthine--ammonia ligase isoform X2 [Phoenix dactylifera] Length = 732 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMM+CI+HGHEIVALANL+P D Sbjct: 1 MKVVALVSGGKDSCYAMMRCIDHGHEIVALANLLPFD 37 >ref|XP_008810317.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Phoenix dactylifera] Length = 737 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMM+CI+HGHEIVALANL+P D Sbjct: 1 MKVVALVSGGKDSCYAMMRCIDHGHEIVALANLLPFD 37 >ref|XP_010102215.1| hypothetical protein L484_024496 [Morus notabilis] gi|587904962|gb|EXB93158.1| hypothetical protein L484_024496 [Morus notabilis] Length = 765 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANLMP D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLMPAD 37 >ref|XP_009419957.1| PREDICTED: diphthine--ammonia ligase isoform X2 [Musa acuminata subsp. malaccensis] Length = 710 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMM+CI++GHEIVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMRCIDYGHEIVALANLMPLD 37 >ref|XP_009419955.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Musa acuminata subsp. malaccensis] Length = 714 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMM+CI++GHEIVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMRCIDYGHEIVALANLMPLD 37 >ref|XP_002521986.1| protein with unknown function [Ricinus communis] gi|223538790|gb|EEF40390.1| protein with unknown function [Ricinus communis] Length = 745 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -3 Query: 115 EMKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 +MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 2 KMKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 39 >ref|XP_002325340.1| endoribonuclease L-PSP family protein [Populus trichocarpa] gi|222862215|gb|EEE99721.1| endoribonuclease L-PSP family protein [Populus trichocarpa] Length = 751 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANLMP D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLMPAD 37 >ref|XP_010463925.1| PREDICTED: diphthine--ammonia ligase-like [Camelina sativa] Length = 721 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 37 >ref|XP_010415376.1| PREDICTED: diphthine--ammonia ligase-like [Camelina sativa] gi|727411017|ref|XP_010415451.1| PREDICTED: diphthine--ammonia ligase-like [Camelina sativa] Length = 722 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 37 >ref|XP_013450430.1| meiotically up-regulated protein 71-like protein [Medicago truncatula] gi|657380252|gb|KEH24458.1| meiotically up-regulated protein 71-like protein [Medicago truncatula] Length = 728 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GH+IVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHQIVALANLMPVD 37 >ref|XP_003626157.2| meiotically up-regulated protein 71-like protein [Medicago truncatula] gi|657380251|gb|AES82375.2| meiotically up-regulated protein 71-like protein [Medicago truncatula] Length = 739 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GH+IVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHQIVALANLMPVD 37 >ref|XP_006297070.1| hypothetical protein CARUB_v10013071mg [Capsella rubella] gi|482565779|gb|EOA29968.1| hypothetical protein CARUB_v10013071mg [Capsella rubella] Length = 721 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 37 >ref|NP_187098.2| endoribonuclease [Arabidopsis thaliana] gi|332640566|gb|AEE74087.1| endoribonuclease [Arabidopsis thaliana] Length = 718 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 37 >gb|AAF63779.1| unknown protein [Arabidopsis thaliana] Length = 715 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKCI++GHEIVALANL+P+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCIQYGHEIVALANLLPVD 37 >ref|XP_011080568.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Sesamum indicum] gi|747067673|ref|XP_011080570.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Sesamum indicum] gi|747067675|ref|XP_011080571.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Sesamum indicum] gi|747067677|ref|XP_011080572.1| PREDICTED: diphthine--ammonia ligase isoform X1 [Sesamum indicum] Length = 744 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKC E+GHEIVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCQEYGHEIVALANLMPVD 37 >ref|XP_010043303.1| PREDICTED: diphthine--ammonia ligase [Eucalyptus grandis] Length = 731 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 112 MKVVGLVSGGKDSCYAMMKCIEHGHEIVALANLMPMD 2 MKVV LVSGGKDSCYAMMKC+++GH+IVALANLMP+D Sbjct: 1 MKVVALVSGGKDSCYAMMKCVQYGHQIVALANLMPVD 37