BLASTX nr result
ID: Cinnamomum24_contig00025758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025758 (223 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308700.2| PREDICTED: glutamate receptor 2.8-like [Frag... 71 4e-10 ref|XP_004292141.2| PREDICTED: glutamate receptor 2.8-like [Frag... 70 6e-10 ref|XP_008220616.1| PREDICTED: glutamate receptor 2.8-like [Prun... 70 6e-10 ref|XP_007225371.1| hypothetical protein PRUPE_ppa000839mg [Prun... 70 6e-10 ref|XP_012571548.1| PREDICTED: glutamate receptor 2.7-like isofo... 69 1e-09 ref|XP_004501403.1| PREDICTED: glutamate receptor 2.7-like isofo... 69 1e-09 ref|XP_003603256.1| glutamate receptor 3.2 [Medicago truncatula]... 69 1e-09 ref|XP_004295824.2| PREDICTED: glutamate receptor 2.8-like [Frag... 68 3e-09 ref|XP_013721831.1| PREDICTED: glutamate receptor 2.7-like [Bras... 66 9e-09 ref|XP_013690060.1| PREDICTED: glutamate receptor 2.7-like, part... 66 9e-09 ref|XP_013746035.1| PREDICTED: glutamate receptor 2.7-like [Bras... 66 9e-09 ref|XP_013746034.1| PREDICTED: glutamate receptor 2.7-like [Bras... 66 9e-09 ref|XP_007011639.1| Glutamate receptor 2.9 [Theobroma cacao] gi|... 66 9e-09 ref|NP_180475.2| glutamate receptor 2.8 [Arabidopsis thaliana] g... 65 1e-08 emb|CAC29254.1| ligand gated channel-like protein precursor [Ara... 65 1e-08 ref|XP_008359434.1| PREDICTED: glutamate receptor 2.8-like [Malu... 65 1e-08 ref|XP_008350102.1| PREDICTED: glutamate receptor 2.8-like [Malu... 65 1e-08 ref|XP_013461855.1| glutamate receptor 3.2 [Medicago truncatula]... 65 1e-08 gb|AAC33237.1| putative ligand-gated ion channel protein [Arabid... 65 1e-08 ref|XP_008359399.1| PREDICTED: glutamate receptor 2.7-like [Malu... 65 2e-08 >ref|XP_004308700.2| PREDICTED: glutamate receptor 2.8-like [Fragaria vesca subsp. vesca] Length = 982 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/66 (46%), Positives = 47/66 (71%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 +FWGLFL+ G SVLA +I L +FLYK+RH+LI + S Q ++ T++ FN++D S H Sbjct: 840 TFWGLFLIAGAASVLALIIFLASFLYKHRHILINAEPGGSTQGKIRTLLEIFNKKDFSSH 899 Query: 42 TFRTSK 25 T +T++ Sbjct: 900 TLKTTQ 905 >ref|XP_004292141.2| PREDICTED: glutamate receptor 2.8-like [Fragaria vesca subsp. vesca] Length = 958 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/67 (44%), Positives = 47/67 (70%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFLV+G S++A +I + +F Y++RH+L+ D +S R+ + + FNE+DL H Sbjct: 835 SFWGLFLVSGVASIIALMIFVASFTYRHRHILVHPDTRVSTWGRIQVMFKIFNEKDLESH 894 Query: 42 TFRTSKS 22 TF++S S Sbjct: 895 TFKSSSS 901 >ref|XP_008220616.1| PREDICTED: glutamate receptor 2.8-like [Prunus mume] Length = 921 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/66 (48%), Positives = 47/66 (71%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S+LA +I L +FLYK+RHVL D+ S +R+ + FN++D+S H Sbjct: 778 SFWGLFLIAGMASILALIIFLASFLYKHRHVLKQSDSRASKWRRVRAMFEIFNDKDISSH 837 Query: 42 TFRTSK 25 TF++S+ Sbjct: 838 TFKSSQ 843 >ref|XP_007225371.1| hypothetical protein PRUPE_ppa000839mg [Prunus persica] gi|462422307|gb|EMJ26570.1| hypothetical protein PRUPE_ppa000839mg [Prunus persica] Length = 985 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/66 (48%), Positives = 47/66 (71%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S+LA +I L +FLYK+RHVL D+ S +R+ + FN++D+S H Sbjct: 842 SFWGLFLIAGMASILALIIFLASFLYKHRHVLKQSDSRASKWRRVRAMFEIFNDKDISSH 901 Query: 42 TFRTSK 25 TF++S+ Sbjct: 902 TFKSSQ 907 >ref|XP_012571548.1| PREDICTED: glutamate receptor 2.7-like isoform X1 [Cicer arietinum] Length = 933 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/68 (44%), Positives = 47/68 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G +S+LA LI + TFLY+++H+ + + S + + ++R F++RDL H Sbjct: 820 SFWGLFLIAGLSSLLALLIFVVTFLYQHKHIWLDSNTGTSIWRSIKVLVRVFDQRDLDSH 879 Query: 42 TFRTSKSI 19 TF+ SK I Sbjct: 880 TFKKSKMI 887 >ref|XP_004501403.1| PREDICTED: glutamate receptor 2.7-like isoform X2 [Cicer arietinum] Length = 991 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/68 (44%), Positives = 47/68 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G +S+LA LI + TFLY+++H+ + + S + + ++R F++RDL H Sbjct: 843 SFWGLFLIAGLSSLLALLIFVVTFLYQHKHIWLDSNTGTSIWRSIKVLVRVFDQRDLDSH 902 Query: 42 TFRTSKSI 19 TF+ SK I Sbjct: 903 TFKKSKMI 910 >ref|XP_003603256.1| glutamate receptor 3.2 [Medicago truncatula] gi|355492304|gb|AES73507.1| glutamate receptor 3.2 [Medicago truncatula] Length = 990 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/70 (42%), Positives = 50/70 (71%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S+LA LI + TFL++++H+ + + S S +R+ + R F++RDLS H Sbjct: 852 SFWGLFLIAGIASLLALLIFVVTFLHQHKHIWLNNNPSNSIWRRIEVVFRMFDQRDLSSH 911 Query: 42 TFRTSKSIED 13 TF+ +++I + Sbjct: 912 TFKKTENINE 921 >ref|XP_004295824.2| PREDICTED: glutamate receptor 2.8-like [Fragaria vesca subsp. vesca] Length = 958 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/66 (43%), Positives = 48/66 (72%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G SV A +I++ +FL+K++HVL+ D+ S +R+ + FN+++L+ H Sbjct: 815 SFWGLFLIAGIASVFALIISITSFLHKHKHVLMPPDSGTSKWKRIRAMFEIFNQKELNSH 874 Query: 42 TFRTSK 25 TFR+S+ Sbjct: 875 TFRSSR 880 >ref|XP_013721831.1| PREDICTED: glutamate receptor 2.7-like [Brassica napus] Length = 946 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/65 (46%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G TS+LA L+ + F Y++RH L D+ ISF ++L ++R F+E+D+ H Sbjct: 816 SFWGLFLIVGVTSLLALLVFVAFFFYEHRHTLYE-DSEISFWRKLTILVRSFDEKDIKSH 874 Query: 42 TFRTS 28 F+ S Sbjct: 875 MFKDS 879 >ref|XP_013690060.1| PREDICTED: glutamate receptor 2.7-like, partial [Brassica napus] Length = 584 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/65 (46%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G TS+LA L+ + F Y++RH L D+ ISF ++L ++R F+E+D+ H Sbjct: 454 SFWGLFLIVGVTSLLALLVFVAFFFYEHRHTLYE-DSEISFWRKLTILVRSFDEKDIKSH 512 Query: 42 TFRTS 28 F+ S Sbjct: 513 MFKDS 517 >ref|XP_013746035.1| PREDICTED: glutamate receptor 2.7-like [Brassica napus] Length = 880 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/65 (46%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G TS+LA L+ + F Y++RH L D+ ISF ++L ++R F+E+D+ H Sbjct: 750 SFWGLFLIVGVTSLLALLVFVAFFFYEHRHTLYE-DSEISFWRKLTILVRSFDEKDIKSH 808 Query: 42 TFRTS 28 F+ S Sbjct: 809 MFKDS 813 >ref|XP_013746034.1| PREDICTED: glutamate receptor 2.7-like [Brassica napus] Length = 659 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/65 (46%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G TS+LA L+ + F Y++RH L D+ ISF ++L ++R F+E+D+ H Sbjct: 529 SFWGLFLIVGVTSLLALLVFVAFFFYEHRHTLYE-DSEISFWRKLTILVRSFDEKDIKSH 587 Query: 42 TFRTS 28 F+ S Sbjct: 588 MFKDS 592 >ref|XP_007011639.1| Glutamate receptor 2.9 [Theobroma cacao] gi|508782002|gb|EOY29258.1| Glutamate receptor 2.9 [Theobroma cacao] Length = 987 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G TS+ A +I FLY+ RHVL + F +R++ + R F++RDLS H Sbjct: 836 SFWGLFLIAGVTSISALIIFAAMFLYEQRHVLFRFCSETPFWRRILFLSRIFDQRDLSSH 895 Query: 42 TFRTSK 25 TF+ S+ Sbjct: 896 TFKRSE 901 >ref|NP_180475.2| glutamate receptor 2.8 [Arabidopsis thaliana] gi|41017226|sp|Q9C5V5.2|GLR28_ARATH RecName: Full=Glutamate receptor 2.8; AltName: Full=Ligand-gated ion channel 2.8; Flags: Precursor gi|330253118|gb|AEC08212.1| glutamate receptor 2.8 [Arabidopsis thaliana] Length = 947 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/65 (47%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S LA LI +F FLY+ RH L D+ S ++L ++ R+F+E+D+ H Sbjct: 816 SFWGLFLIAGIASFLALLIFVFLFLYENRHTLCD-DSEDSIWRKLTSLFRNFDEKDIKSH 874 Query: 42 TFRTS 28 TF++S Sbjct: 875 TFKSS 879 >emb|CAC29254.1| ligand gated channel-like protein precursor [Arabidopsis thaliana] Length = 947 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/65 (47%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S LA LI +F FLY+ RH L D+ S ++L ++ R+F+E+D+ H Sbjct: 816 SFWGLFLIAGIASFLALLIFVFLFLYENRHTLCD-DSEDSIWRKLTSLFRNFDEKDIKSH 874 Query: 42 TFRTS 28 TF++S Sbjct: 875 TFKSS 879 >ref|XP_008359434.1| PREDICTED: glutamate receptor 2.8-like [Malus domestica] Length = 896 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQ-QRLITIIRHFNERDLSH 46 SFWGLFL+ G S+LA +I + F YK+RHVL D+ S + +R+ +I FNE+DL+ Sbjct: 757 SFWGLFLIAGAASILALIIFIACFFYKHRHVLEQPDSRTSSRWRRVRALIEIFNEKDLNS 816 Query: 45 HTFRTSKSIEDL 10 HTF++ + E + Sbjct: 817 HTFKSRQQQEGI 828 >ref|XP_008350102.1| PREDICTED: glutamate receptor 2.8-like [Malus domestica] Length = 1385 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQ-QRLITIIRHFNERDLSH 46 SFWGLFL+ G S+LA +I + F YK+RHVL D+ S + +R+ +I FNE+DL+ Sbjct: 768 SFWGLFLIAGAASILALIIFIACFFYKHRHVLEQPDSRTSSRWRRVRALIEIFNEKDLNS 827 Query: 45 HTFRTSKSIEDL 10 HTF++ + E + Sbjct: 828 HTFKSRQQQEGI 839 >ref|XP_013461855.1| glutamate receptor 3.2 [Medicago truncatula] gi|657395647|gb|KEH35890.1| glutamate receptor 3.2 [Medicago truncatula] Length = 869 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/65 (44%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S+LA LI + TFLY+++H+ + S S +R+ ++ F++RDL+ H Sbjct: 735 SFWGLFLIAGIASLLALLIFVITFLYQHKHIWLPNSPSNSIWRRIRVLVMIFDQRDLNSH 794 Query: 42 TFRTS 28 TF+ S Sbjct: 795 TFKKS 799 >gb|AAC33237.1| putative ligand-gated ion channel protein [Arabidopsis thaliana] Length = 958 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/65 (47%), Positives = 45/65 (69%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G S LA LI +F FLY+ RH L D+ S ++L ++ R+F+E+D+ H Sbjct: 827 SFWGLFLIAGIASFLALLIFVFLFLYENRHTLCD-DSEDSIWRKLTSLFRNFDEKDIKSH 885 Query: 42 TFRTS 28 TF++S Sbjct: 886 TFKSS 890 >ref|XP_008359399.1| PREDICTED: glutamate receptor 2.7-like [Malus domestica] Length = 968 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/65 (46%), Positives = 46/65 (70%) Frame = -2 Query: 222 SFWGLFLVTGTTSVLAFLINLFTFLYKYRHVLITCDASISFQQRLITIIRHFNERDLSHH 43 SFWGLFL+ G +S+ A +I +F Y++RH+ +T DA S +R+ ++R F+++DLS H Sbjct: 840 SFWGLFLIAGVSSISALIIFAASFCYRHRHIFMTTDA--SGWKRIRAMLRFFDQKDLSSH 897 Query: 42 TFRTS 28 TFR S Sbjct: 898 TFRQS 902