BLASTX nr result
ID: Cinnamomum24_contig00025751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025751 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008786740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 87 6e-15 ref|XP_007210219.1| hypothetical protein PRUPE_ppa015814mg [Prun... 86 1e-14 ref|XP_008374567.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_006849319.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_010258484.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_008239979.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_007155289.1| hypothetical protein PHAVU_003G188300g [Phas... 83 7e-14 gb|KRH56887.1| hypothetical protein GLYMA_05G024900 [Glycine max] 83 9e-14 gb|KHN48701.1| Pentatricopeptide repeat-containing protein, mito... 83 9e-14 ref|XP_009339137.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 ref|XP_010918344.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_007037432.1| Pentatricopeptide repeat superfamily protein... 82 1e-13 ref|XP_014508098.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-13 gb|KNA19539.1| hypothetical protein SOVF_060780 [Spinacia oleracea] 81 4e-13 gb|KRH03514.1| hypothetical protein GLYMA_17G102300 [Glycine max... 80 6e-13 gb|KHN18570.1| Pentatricopeptide repeat-containing protein, mito... 80 6e-13 gb|KOM33295.1| hypothetical protein LR48_Vigan01g285100 [Vigna a... 80 8e-13 gb|KFK27895.1| hypothetical protein AALP_AA8G444100 [Arabis alpina] 79 1e-12 ref|XP_013447947.1| PPR containing plant-like protein [Medicago ... 79 1e-12 ref|XP_006394515.1| hypothetical protein EUTSA_v10004085mg [Eutr... 78 2e-12 >ref|XP_008786740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g61370, mitochondrial, partial [Phoenix dactylifera] Length = 485 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/51 (74%), Positives = 41/51 (80%) Frame = -2 Query: 332 DHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 D GP YDLLI K C G FD GR+LW+EA ERGI+LQCS DLLDPSKTEVF Sbjct: 388 DQGPTYDLLIEKLCRSGRFDAGRRLWEEAAERGIILQCSKDLLDPSKTEVF 438 >ref|XP_007210219.1| hypothetical protein PRUPE_ppa015814mg [Prunus persica] gi|462405954|gb|EMJ11418.1| hypothetical protein PRUPE_ppa015814mg [Prunus persica] Length = 524 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI KFC GG+F+KGR+LWDEA+ G+ L+CSSDLLDPS TEVF Sbjct: 358 GGYGPVYDVLIPKFCRGGDFEKGRELWDEAMAMGVTLRCSSDLLDPSITEVF 409 >ref|XP_008374567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Malus domestica] Length = 501 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI KFC GG+F+KGR+LWDEAV GI L+CSS+LLDPS TEVF Sbjct: 393 GGYGPVYDVLIPKFCRGGDFEKGRELWDEAVAMGITLRCSSNLLDPSITEVF 444 >ref|XP_006849319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Amborella trichopoda] gi|548852840|gb|ERN10900.1| hypothetical protein AMTR_s00164p00020970 [Amborella trichopoda] Length = 459 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 329 HGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 +GP YDLLI K C GG+F+ GRKLWDEA+ERG VLQCS DLLDPSKTEV+ Sbjct: 375 YGPTYDLLITKLCKGGKFEIGRKLWDEALERGAVLQCSVDLLDPSKTEVY 424 >ref|XP_010258484.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Nelumbo nucifera] Length = 483 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/51 (70%), Positives = 47/51 (92%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEV 183 GD+GPVYDLLI K C+ GEF+KGR+LWDEA+E+G++LQCSS++LDPS T+V Sbjct: 391 GDYGPVYDLLIPKLCSLGEFEKGRQLWDEALEKGVILQCSSNVLDPSITKV 441 >ref|XP_008239979.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Prunus mume] gi|645269400|ref|XP_008239981.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Prunus mume] Length = 456 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI KFC GG+F+KGR+LWDEA+ G+ L+CSS+LLDPS TEVF Sbjct: 358 GGYGPVYDVLIPKFCRGGDFEKGRELWDEAMAMGVTLRCSSELLDPSITEVF 409 >ref|XP_007155289.1| hypothetical protein PHAVU_003G188300g [Phaseolus vulgaris] gi|561028643|gb|ESW27283.1| hypothetical protein PHAVU_003G188300g [Phaseolus vulgaris] Length = 494 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K CTGG F+KGR+LWDEA GI+LQCS D+LDPS T+V+ Sbjct: 396 GGYGPVYDVLIPKLCTGGNFEKGRELWDEATSMGIILQCSEDVLDPSITQVY 447 >gb|KRH56887.1| hypothetical protein GLYMA_05G024900 [Glycine max] Length = 453 Score = 82.8 bits (203), Expect = 9e-14 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDEA + GI L CS D+LDPSKTEV+ Sbjct: 359 GGYGPVYDVLIPKLCRGGDFEKGRELWDEATDMGITLLCSEDVLDPSKTEVY 410 >gb|KHN48701.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 395 Score = 82.8 bits (203), Expect = 9e-14 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDEA + GI L CS D+LDPSKTEV+ Sbjct: 301 GGYGPVYDVLIPKLCRGGDFEKGRELWDEATDMGITLLCSEDVLDPSKTEVY 352 >ref|XP_009339137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Pyrus x bretschneideri] Length = 501 Score = 82.8 bits (203), Expect = 9e-14 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI KFC G+F+KGR+LWDEAV G+ L+CSS+LLDPS TEVF Sbjct: 393 GGYGPVYDVLIPKFCRAGDFEKGRELWDEAVAMGVTLRCSSNLLDPSITEVF 444 >ref|XP_010918344.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Elaeis guineensis] Length = 473 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -2 Query: 332 DHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 + GP YDLLI K C G FD GR+LW+EA ERGI+LQCS DLLDPSKT+VF Sbjct: 388 EQGPTYDLLIEKLCRIGRFDAGRRLWEEAAERGIILQCSKDLLDPSKTDVF 438 >ref|XP_007037432.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508774677|gb|EOY21933.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 487 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDEAV G+ L CSSD+LDPS TEVF Sbjct: 390 GGYGPVYDVLIPKLCRGGDFEKGRELWDEAVATGVSLSCSSDVLDPSITEVF 441 >ref|XP_014508098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Vigna radiata var. radiata] Length = 496 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG F+KGR+LWDEA GI+LQCS D+LDPS T+V+ Sbjct: 396 GGYGPVYDVLIPKLCRGGNFEKGRELWDEATSMGIILQCSEDVLDPSITQVY 447 >gb|KNA19539.1| hypothetical protein SOVF_060780 [Spinacia oleracea] Length = 487 Score = 80.9 bits (198), Expect = 4e-13 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 GD+GPVYD+LI K C GG+F+KGR+LWDEA GI L+CS D+LDPS T+VF Sbjct: 383 GDYGPVYDVLIPKLCRGGDFEKGRELWDEAERMGIPLRCSRDVLDPSITQVF 434 >gb|KRH03514.1| hypothetical protein GLYMA_17G102300 [Glycine max] gi|947054062|gb|KRH03515.1| hypothetical protein GLYMA_17G102300 [Glycine max] Length = 490 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDEA GI LQCS D+LDPS TEV+ Sbjct: 396 GGYGPVYDVLIPKLCRGGDFEKGRELWDEASGMGITLQCSEDVLDPSITEVY 447 >gb|KHN18570.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 437 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDEA GI LQCS D+LDPS TEV+ Sbjct: 343 GGYGPVYDVLIPKLCRGGDFEKGRELWDEASGMGITLQCSEDVLDPSITEVY 394 >gb|KOM33295.1| hypothetical protein LR48_Vigan01g285100 [Vigna angularis] Length = 496 Score = 79.7 bits (195), Expect = 8e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG F+KGR+LWDEA GI+LQC+ D+LDPS T+V+ Sbjct: 396 GGYGPVYDVLIPKLCRGGNFEKGRELWDEATSMGIILQCTEDVLDPSITQVY 447 >gb|KFK27895.1| hypothetical protein AALP_AA8G444100 [Arabis alpina] Length = 489 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYDLLI K C GG+F+KGR+LW+EA+ G+ CS DLLDPS TEVF Sbjct: 389 GGYGPVYDLLIPKLCKGGDFEKGRELWEEAISLGVAHSCSVDLLDPSVTEVF 440 >ref|XP_013447947.1| PPR containing plant-like protein [Medicago truncatula] gi|657377053|gb|KEH21974.1| PPR containing plant-like protein [Medicago truncatula] Length = 365 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYD+LI K C GG+F+KGR+LWDE GI LQCS D+LDPS TEV+ Sbjct: 266 GGYGPVYDVLIPKLCRGGDFEKGRELWDEGTFMGITLQCSKDVLDPSITEVY 317 >ref|XP_006394515.1| hypothetical protein EUTSA_v10004085mg [Eutrema salsugineum] gi|557091154|gb|ESQ31801.1| hypothetical protein EUTSA_v10004085mg [Eutrema salsugineum] Length = 489 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -2 Query: 335 GDHGPVYDLLIAKFCTGGEFDKGRKLWDEAVERGIVLQCSSDLLDPSKTEVF 180 G +GPVYDLLI K C GG+F+KGR+LW+EA+ + L CS DLLDPS TEVF Sbjct: 389 GGYGPVYDLLIPKLCKGGDFEKGRELWEEAMSLDVTLSCSVDLLDPSLTEVF 440