BLASTX nr result
ID: Cinnamomum24_contig00025284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025284 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085586.1| hypothetical protein ArthMp108 [Arabidopsis tha... 75 2e-11 >ref|NP_085586.1| hypothetical protein ArthMp108 [Arabidopsis thaliana] gi|45477078|sp|P92564.1|M1350_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01350; AltName: Full=ORF145c gi|1785787|emb|CAA69784.1| unnamed protein product [Arabidopsis thaliana] Length = 145 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/58 (63%), Positives = 43/58 (74%) Frame = -2 Query: 251 SRSAPFSTIVRNLLNEVEAPERLSYLSDMYKSLVENGIHSPFFYEIVQAFLAIMGGGG 78 SR+APF TI+ LL V ERL+YLS+MY SL+E GI SP FY IVQ FL +MGGGG Sbjct: 85 SRNAPFPTILEQLLATVSQEERLAYLSNMYNSLIEMGIDSPCFYPIVQTFLFLMGGGG 142