BLASTX nr result
ID: Cinnamomum24_contig00024492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024492 (885 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523538.1| conserved hypothetical protein [Ricinus comm... 58 8e-06 >ref|XP_002523538.1| conserved hypothetical protein [Ricinus communis] gi|223537245|gb|EEF38877.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 58.2 bits (139), Expect = 8e-06 Identities = 47/118 (39%), Positives = 58/118 (49%) Frame = -2 Query: 755 KPPRNASFKSNCNGRHRKRWCKDTGPMVVKLPSATNLVMGQVKILKRGEKLDPSSPSKDL 576 KPPRN ++ HR R +G MV K PS N VMG+VKILKRGE L Sbjct: 32 KPPRNPQAFNH----HRSR----SGAMVAKFPSR-NFVMGEVKILKRGESL--------A 74 Query: 575 QSDPLKDSSKDERXXXXXXXXXXXXXXXXXXSTGRLGPDPDLAPKPIRLSVDATIYAG 402 + D S K++R ST RLGPDP+ + IRLS++ IYAG Sbjct: 75 KVDKRGLSKKEKRKHPTMIMKIEKDPDLILGSTDRLGPDPETVQEQIRLSIN-EIYAG 131