BLASTX nr result
ID: Cinnamomum24_contig00024297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024297 (285 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203483.1| hypothetical protein PRUPE_ppa022373mg, part... 56 9e-06 ref|XP_007200264.1| hypothetical protein PRUPE_ppa014991mg, part... 56 9e-06 >ref|XP_007203483.1| hypothetical protein PRUPE_ppa022373mg, partial [Prunus persica] gi|462399014|gb|EMJ04682.1| hypothetical protein PRUPE_ppa022373mg, partial [Prunus persica] Length = 561 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = +2 Query: 11 GLGIFNYDPTNARYQLIKYIISRQYPFILAEDRCFERFLRSAFVPSWQKISKVTARSDAT 190 G+ F Y R +L ++I + PF AE+RCFERF++ A P ++K+S+ T RSD Sbjct: 9 GISSFKYSQAKMRVELARFIACAELPFRFAENRCFERFVQVALQPEFKKVSRNTNRSDVV 68 Query: 191 K 193 K Sbjct: 69 K 69 >ref|XP_007200264.1| hypothetical protein PRUPE_ppa014991mg, partial [Prunus persica] gi|462395664|gb|EMJ01463.1| hypothetical protein PRUPE_ppa014991mg, partial [Prunus persica] Length = 526 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = +2 Query: 11 GLGIFNYDPTNARYQLIKYIISRQYPFILAEDRCFERFLRSAFVPSWQKISKVTARSDAT 190 G+ F Y R +L ++I + PF AE+RCFERF++ A P ++K+S+ T RSD Sbjct: 9 GISSFKYSQAKMRVELARFIACAELPFRFAENRCFERFVQVALQPEFKKVSRNTNRSDVV 68 Query: 191 K 193 K Sbjct: 69 K 69