BLASTX nr result
ID: Cinnamomum24_contig00024278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024278 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containin... 86 1e-14 ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containin... 81 4e-13 ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containin... 81 4e-13 ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containin... 81 4e-13 ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containin... 81 4e-13 ref|XP_012568557.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 ... 80 6e-13 ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containin... 80 6e-13 ref|XP_013462493.1| katanin p80 WD40 repeat subunit B1-like prot... 80 6e-13 ref|XP_003593480.2| katanin p80 WD40 repeat subunit B1-like prot... 80 6e-13 ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Popu... 80 6e-13 ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containin... 78 2e-12 ref|XP_014518573.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 4e-12 ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phas... 77 4e-12 gb|KMS96766.1| hypothetical protein BVRB_8g199500 isoform C [Bet... 77 5e-12 ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 5e-12 ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 5e-12 ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 5e-12 ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 7e-12 ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 7e-12 ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containin... 77 7e-12 >ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Nelumbo nucifera] Length = 786 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AHAS+V C+ IGKKSC L VTGGEDHRVNLWA GK NSLL Sbjct: 1 MAKRGYKLQEFVAHASSVNCLSIGKKSCRLLVTGGEDHRVNLWAIGKPNSLL 52 >ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis sativus] Length = 976 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLM 52 >ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis sativus] gi|700209542|gb|KGN64638.1| hypothetical protein Csa_1G072490 [Cucumis sativus] Length = 978 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLM 52 >ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis melo] Length = 920 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLM 52 >ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis melo] Length = 922 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+ NV C+ IGKK+C LF+TGG+D++VNLWA GK NSL+ Sbjct: 1 MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLM 52 >ref|XP_012568557.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing subunit B1 homolog [Cicer arietinum] Length = 1121 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSL 4 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSL 51 >ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Populus euphratica] Length = 959 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C+ IGKK+C +F+TGG+DH+VNLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLM 52 >ref|XP_013462493.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] gi|657396574|gb|KEH36528.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1030 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSL 4 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSL 51 >ref|XP_003593480.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] gi|657396573|gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1111 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSL 4 MAKRGYK E AH+SNV C+ IGKK+C LFVTGG+DH+VNLW GK SL Sbjct: 1 MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSL 51 >ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] gi|550327580|gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] Length = 990 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C+ IGKK+C +F+TGG+DH+VNLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLM 52 >ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Eucalyptus grandis] gi|629109497|gb|KCW74643.1| hypothetical protein EUGRSUZ_E03367 [Eucalyptus grandis] Length = 1017 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 M+KRGYK E AH+SNV C+ IGKK+C LF+TGG+D +VNLWA GK NSL+ Sbjct: 1 MSKRGYKLQEFVAHSSNVNCLSIGKKACRLFLTGGDDCKVNLWAIGKPNSLM 52 >ref|XP_014518573.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Vigna radiata var. radiata] Length = 826 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+++V C+ IGKK+C LF+TGG+DH+VNLW GK SL+ Sbjct: 1 MAKRGYKIQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTSLM 52 >ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] gi|561021439|gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] Length = 828 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH+++V C+ IGKK+C LF+TGG+DH+VNLW GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTSLM 52 >gb|KMS96766.1| hypothetical protein BVRB_8g199500 isoform C [Beta vulgaris subsp. vulgaris] Length = 819 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLM 52 >ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Beta vulgaris subsp. vulgaris] Length = 820 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLM 52 >ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Beta vulgaris subsp. vulgaris] gi|870843624|gb|KMS96764.1| hypothetical protein BVRB_8g199500 isoform A [Beta vulgaris subsp. vulgaris] Length = 820 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLM 52 >ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Beta vulgaris subsp. vulgaris] gi|870843625|gb|KMS96765.1| hypothetical protein BVRB_8g199500 isoform B [Beta vulgaris subsp. vulgaris] Length = 821 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C++IGKK+C L +TGG+DH+ NLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLM 52 >ref|XP_012091536.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Jatropha curcas] Length = 936 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C+ IGKK+C LF+TGG+D++VNLW GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRLFITGGDDNKVNLWTIGKPTSLM 52 >ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Vitis vinifera] Length = 806 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH +NV C+ IGKK+C L ++GG+DH+VNLWA GK SL+ Sbjct: 1 MAKRGYKLQEFVAHTTNVNCLNIGKKACRLLISGGDDHKVNLWAIGKPTSLM 52 >ref|XP_012091535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Jatropha curcas] gi|643703848|gb|KDP20912.1| hypothetical protein JCGZ_21383 [Jatropha curcas] Length = 941 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 156 MAKRGYKFYEVEAHASNVKCIKIGKKSCGLFVTGGEDHRVNLWAFGKSNSLL 1 MAKRGYK E AH++NV C+ IGKK+C LF+TGG+D++VNLW GK SL+ Sbjct: 1 MAKRGYKLQEFVAHSTNVNCLSIGKKACRLFITGGDDNKVNLWTIGKPTSLM 52