BLASTX nr result
ID: Cinnamomum24_contig00024255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024255 (893 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010256457.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-09 ref|XP_009371172.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 66 4e-08 ref|XP_010930166.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-08 ref|XP_011462603.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-07 ref|XP_011073904.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-07 ref|XP_004978096.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-06 ref|XP_002519389.1| pentatricopeptide repeat-containing protein,... 61 1e-06 ref|XP_009401150.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-06 ref|XP_010650487.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-06 ref|XP_010650483.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-06 gb|KDO46449.1| hypothetical protein CISIN_1g001911mg [Citrus sin... 60 3e-06 ref|XP_006443117.1| hypothetical protein CICLE_v10018682mg [Citr... 60 3e-06 ref|XP_006443116.1| hypothetical protein CICLE_v10018682mg [Citr... 60 3e-06 ref|XP_002446703.1| hypothetical protein SORBIDRAFT_06g020845, p... 60 3e-06 ref|XP_008669244.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-06 tpg|DAA37220.1| TPA: hypothetical protein ZEAMMB73_348855 [Zea m... 59 4e-06 >ref|XP_010256457.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Nelumbo nucifera] gi|720001756|ref|XP_010256459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Nelumbo nucifera] Length = 1083 Score = 68.9 bits (167), Expect = 5e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 891 HIPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQA 760 +IPEL +F L+KGLI+VN+WDEAL L S+CHMEI+WHSRE + Sbjct: 1035 YIPELTVFLYLIKGLIKVNKWDEALQLLDSICHMEISWHSREDS 1078 >ref|XP_009371172.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Pyrus x bretschneideri] Length = 952 Score = 65.9 bits (159), Expect = 4e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 885 PELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFD 754 PELD FF L+KGLI+ N WDEAL L S+CHM+I+WH +E+ D Sbjct: 907 PELDTFFHLIKGLIKANNWDEALQLXDSICHMDIHWHMQEETSD 950 >ref|XP_010930166.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X1 [Elaeis guineensis] Length = 1015 Score = 65.1 bits (157), Expect = 7e-08 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 891 HIPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFDGS 748 HIPEL + FCL+KGL+RVN+W+EAL L +S+ HM I+W+S+E FD S Sbjct: 969 HIPELTVLFCLIKGLLRVNKWNEALQLCYSIYHMGIHWYSQE-GFDRS 1015 >ref|XP_011462603.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570866|ref|XP_011462604.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570870|ref|XP_011462605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570874|ref|XP_011462606.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570877|ref|XP_011462607.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570880|ref|XP_011462608.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570884|ref|XP_011462609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570887|ref|XP_011462610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] gi|764570891|ref|XP_011462611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] Length = 989 Score = 62.4 bits (150), Expect = 4e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 885 PELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFD 754 PEL FF L+KGLI++NRWDEAL LS S+C M+I W +E+ +D Sbjct: 944 PELSTFFHLIKGLIKINRWDEALQLSDSICQMDIQWLLQEETYD 987 >ref|XP_011073904.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Sesamum indicum] Length = 984 Score = 62.0 bits (149), Expect = 6e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSRE 766 IPE D+F L+KGL++VNRW++ALLLS SLC+M+I W S E Sbjct: 938 IPEFDVFIDLIKGLLKVNRWEDALLLSESLCYMDIRWLSNE 978 >ref|XP_004978096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Setaria italica] gi|835998694|ref|XP_012702746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Setaria italica] gi|835998698|ref|XP_012702747.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Setaria italica] gi|835998703|ref|XP_012702748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Setaria italica] gi|944233460|gb|KQK97822.1| hypothetical protein SETIT_009274mg [Setaria italica] Length = 967 Score = 61.2 bits (147), Expect = 1e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFDG 751 +PEL +F CL+KGL++VN+W+EAL L +S+CH +NW +FDG Sbjct: 922 VPELSVFVCLIKGLVKVNKWNEALQLCYSICHEGVNWQD-NNSFDG 966 >ref|XP_002519389.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541456|gb|EEF43006.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 634 Score = 60.8 bits (146), Expect = 1e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFD 754 +PEL + CL+KGL+RV +W+EAL LS S+C M+I+W +EQ D Sbjct: 588 VPELSMLVCLIKGLLRVGKWEEALQLSDSICQMDIHWVQQEQTVD 632 >ref|XP_009401150.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Musa acuminata subsp. malaccensis] Length = 1018 Score = 60.5 bits (145), Expect = 2e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -3 Query: 891 HIPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSRE 766 ++PEL +FFCL+KGL+RVN+WDEAL L ++ +M I WH+ E Sbjct: 972 YVPELIIFFCLIKGLLRVNKWDEALQLLYTTYNMGIEWHNEE 1013 >ref|XP_010650487.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Vitis vinifera] Length = 1000 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQ 763 IPEL +FF LVKGLIR+NRW+EAL LS +C M+I+W E+ Sbjct: 948 IPELSIFFYLVKGLIRINRWEEALQLSDCICQMDIHWLQVEE 989 >ref|XP_010650483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X1 [Vitis vinifera] gi|731390758|ref|XP_010650484.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X1 [Vitis vinifera] gi|731390760|ref|XP_010650485.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X1 [Vitis vinifera] gi|731390762|ref|XP_010650486.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X1 [Vitis vinifera] Length = 1003 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQ 763 IPEL +FF LVKGLIR+NRW+EAL LS +C M+I+W E+ Sbjct: 948 IPELSIFFYLVKGLIRINRWEEALQLSDCICQMDIHWLQVEE 989 >gb|KDO46449.1| hypothetical protein CISIN_1g001911mg [Citrus sinensis] Length = 997 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 885 PELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQ 763 PEL F L+KGLIRVN+W+EAL LS+S+CH +INW E+ Sbjct: 952 PELSTFVHLIKGLIRVNKWEEALQLSYSICHTDINWLQEEE 992 >ref|XP_006443117.1| hypothetical protein CICLE_v10018682mg [Citrus clementina] gi|568850312|ref|XP_006478859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like isoform X1 [Citrus sinensis] gi|568850314|ref|XP_006478860.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like isoform X2 [Citrus sinensis] gi|557545379|gb|ESR56357.1| hypothetical protein CICLE_v10018682mg [Citrus clementina] Length = 997 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 885 PELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQ 763 PEL F L+KGLIRVN+W+EAL LS+S+CH +INW E+ Sbjct: 952 PELSTFVHLIKGLIRVNKWEEALQLSYSICHTDINWLQEEE 992 >ref|XP_006443116.1| hypothetical protein CICLE_v10018682mg [Citrus clementina] gi|557545378|gb|ESR56356.1| hypothetical protein CICLE_v10018682mg [Citrus clementina] Length = 848 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 885 PELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQ 763 PEL F L+KGLIRVN+W+EAL LS+S+CH +INW E+ Sbjct: 803 PELSTFVHLIKGLIRVNKWEEALQLSYSICHTDINWLQEEE 843 >ref|XP_002446703.1| hypothetical protein SORBIDRAFT_06g020845, partial [Sorghum bicolor] gi|241937886|gb|EES11031.1| hypothetical protein SORBIDRAFT_06g020845, partial [Sorghum bicolor] Length = 802 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFDG 751 +PEL +F CL+KGLI+VN+W+EAL L +S+C +NW S +FDG Sbjct: 757 VPELSVFVCLIKGLIKVNKWNEALQLCYSICDEGVNWQS-NNSFDG 801 >ref|XP_008669244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Zea mays] Length = 1059 Score = 59.3 bits (142), Expect = 4e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFDG 751 +PEL F CL+KGLI+VN+W+EAL L +S+C +NW S +FDG Sbjct: 1014 VPELSAFICLIKGLIKVNKWNEALQLCYSMCDEGVNWQS-NNSFDG 1058 >tpg|DAA37220.1| TPA: hypothetical protein ZEAMMB73_348855 [Zea mays] gi|414586650|tpg|DAA37221.1| TPA: hypothetical protein ZEAMMB73_348855 [Zea mays] Length = 969 Score = 59.3 bits (142), Expect = 4e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 888 IPELDLFFCLVKGLIRVNRWDEALLLSHSLCHMEINWHSREQAFDG 751 +PEL F CL+KGLI+VN+W+EAL L +S+C +NW S +FDG Sbjct: 924 VPELSAFICLIKGLIKVNKWNEALQLCYSMCDEGVNWQS-NNSFDG 968