BLASTX nr result
ID: Cinnamomum24_contig00024252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024252 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008810897.1| PREDICTED: GDP-mannose transporter GONST1 [P... 104 2e-20 ref|XP_010911580.1| PREDICTED: GDP-mannose transporter GONST1 [E... 104 3e-20 ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-li... 103 7e-20 ref|XP_008813042.1| PREDICTED: GDP-mannose transporter GONST1-li... 103 7e-20 gb|KRH53900.1| hypothetical protein GLYMA_06G153600 [Glycine max] 101 2e-19 gb|KHN09612.1| GDP-mannose transporter GONST1 [Glycine soja] 101 2e-19 ref|XP_009399237.1| PREDICTED: GDP-mannose transporter GONST1-li... 101 2e-19 ref|XP_009399226.1| PREDICTED: GDP-mannose transporter GONST1-li... 101 2e-19 ref|XP_009399219.1| PREDICTED: GDP-mannose transporter GONST1-li... 101 2e-19 ref|XP_007048393.1| Golgi nucleotide sugar transporter 1 [Theobr... 101 2e-19 ref|XP_004288111.1| PREDICTED: GDP-mannose transporter GONST1 [F... 101 2e-19 ref|XP_010025595.1| PREDICTED: GDP-mannose transporter GONST1 is... 100 4e-19 ref|XP_010025596.1| PREDICTED: GDP-mannose transporter GONST1 is... 100 4e-19 ref|XP_003522487.2| PREDICTED: GDP-mannose transporter GONST1-li... 100 4e-19 ref|XP_007137727.1| hypothetical protein PHAVU_009G150800g [Phas... 100 4e-19 gb|KMZ68794.1| GDP-mannose transporter [Zostera marina] 100 6e-19 gb|KDO50306.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 100 6e-19 gb|KDO50305.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 100 6e-19 gb|KDO50303.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 100 6e-19 ref|XP_006582513.1| PREDICTED: GDP-mannose transporter GONST1-li... 100 6e-19 >ref|XP_008810897.1| PREDICTED: GDP-mannose transporter GONST1 [Phoenix dactylifera] Length = 346 Score = 104 bits (260), Expect = 2e-20 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN +SILFGLLAG+FFAKAKM ERS Sbjct: 287 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENFISILFGLLAGIFFAKAKMRERS 344 >ref|XP_010911580.1| PREDICTED: GDP-mannose transporter GONST1 [Elaeis guineensis] Length = 346 Score = 104 bits (259), Expect = 3e-20 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GIVLFKVPTSLEN +SILFGLLAGVFFAKAK+ ERS Sbjct: 287 HQTGATTYSLVGSLNKIPLSVAGIVLFKVPTSLENFISILFGLLAGVFFAKAKIRERS 344 >ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Phoenix dactylifera] Length = 346 Score = 103 bits (256), Expect = 7e-20 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPT+LEN +SILFGLLAGVFFAKAKM ERS Sbjct: 287 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTTLENFLSILFGLLAGVFFAKAKMRERS 344 >ref|XP_008813042.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Phoenix dactylifera] Length = 407 Score = 103 bits (256), Expect = 7e-20 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPT+LEN +SILFGLLAGVFFAKAKM ERS Sbjct: 348 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTTLENFLSILFGLLAGVFFAKAKMRERS 405 >gb|KRH53900.1| hypothetical protein GLYMA_06G153600 [Glycine max] Length = 342 Score = 101 bits (252), Expect = 2e-19 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK++ERS Sbjct: 283 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKILERS 340 >gb|KHN09612.1| GDP-mannose transporter GONST1 [Glycine soja] Length = 340 Score = 101 bits (252), Expect = 2e-19 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK++ERS Sbjct: 281 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKILERS 338 >ref|XP_009399237.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 330 Score = 101 bits (252), Expect = 2e-19 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 271 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 328 >ref|XP_009399226.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 346 Score = 101 bits (252), Expect = 2e-19 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 287 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 344 >ref|XP_009399219.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 407 Score = 101 bits (252), Expect = 2e-19 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 348 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 405 >ref|XP_007048393.1| Golgi nucleotide sugar transporter 1 [Theobroma cacao] gi|508700654|gb|EOX92550.1| Golgi nucleotide sugar transporter 1 [Theobroma cacao] Length = 398 Score = 101 bits (251), Expect = 2e-19 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GIVLFKVPTSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 341 HQTGATTYSLVGSLNKIPLSVAGIVLFKVPTSLENSASIFFGLLAGVFFARAKMRERS 398 >ref|XP_004288111.1| PREDICTED: GDP-mannose transporter GONST1 [Fragaria vesca subsp. vesca] Length = 336 Score = 101 bits (251), Expect = 2e-19 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GIVLFKVPTSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 279 HQTGATTYSLVGSLNKIPLSVAGIVLFKVPTSLENSASIFFGLLAGVFFARAKMRERS 336 >ref|XP_010025595.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Eucalyptus grandis] Length = 351 Score = 100 bits (249), Expect = 4e-19 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 294 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 351 >ref|XP_010025596.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Eucalyptus grandis] gi|702450873|ref|XP_010025597.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Eucalyptus grandis] gi|629096322|gb|KCW62317.1| hypothetical protein EUGRSUZ_H04965 [Eucalyptus grandis] Length = 336 Score = 100 bits (249), Expect = 4e-19 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 279 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 336 >ref|XP_003522487.2| PREDICTED: GDP-mannose transporter GONST1-like [Glycine max] gi|734400061|gb|KHN31147.1| GDP-mannose transporter GONST1 [Glycine soja] gi|947115738|gb|KRH64040.1| hypothetical protein GLYMA_04G212800 [Glycine max] Length = 342 Score = 100 bits (249), Expect = 4e-19 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 283 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 340 >ref|XP_007137727.1| hypothetical protein PHAVU_009G150800g [Phaseolus vulgaris] gi|561010814|gb|ESW09721.1| hypothetical protein PHAVU_009G150800g [Phaseolus vulgaris] Length = 337 Score = 100 bits (249), Expect = 4e-19 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 278 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 335 >gb|KMZ68794.1| GDP-mannose transporter [Zostera marina] Length = 387 Score = 100 bits (248), Expect = 6e-19 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQT ATTYSLVGSLNKIPLSI GI+LFKVPTS+ENL SILFGLLAGVFFAKAKM +R+ Sbjct: 330 HQTSATTYSLVGSLNKIPLSIAGILLFKVPTSMENLASILFGLLAGVFFAKAKMSDRA 387 >gb|KDO50306.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 226 Score = 100 bits (248), Expect = 6e-19 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GI+LFKVPTSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 166 HQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 223 >gb|KDO50305.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 223 Score = 100 bits (248), Expect = 6e-19 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GI+LFKVPTSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 163 HQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 220 >gb|KDO50303.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 290 Score = 100 bits (248), Expect = 6e-19 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMERS 258 HQTGATTYSLVGSLNKIPLS+ GI+LFKVPTSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 230 HQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 287 >ref|XP_006582513.1| PREDICTED: GDP-mannose transporter GONST1-like [Glycine max] Length = 475 Score = 100 bits (248), Expect = 6e-19 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -1 Query: 431 HQTGATTYSLVGSLNKIPLSIFGIVLFKVPTSLENLVSILFGLLAGVFFAKAKMMER 261 HQTGATTYSLVGSLNKIPLSI GI+LFKVPTSLEN SILFGLLAGVFFA+AK++ER Sbjct: 283 HQTGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKILER 339