BLASTX nr result
ID: Cinnamomum24_contig00022685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00022685 (218 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011658262.1| PREDICTED: putative pentatricopeptide repeat... 72 1e-10 ref|XP_008439708.1| PREDICTED: putative pentatricopeptide repeat... 70 6e-10 ref|XP_010265006.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-09 ref|XP_008224341.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-09 ref|XP_007225005.1| hypothetical protein PRUPE_ppa020300mg [Prun... 69 1e-09 ref|XP_010906775.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_008360419.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_010653129.1| PREDICTED: putative pentatricopeptide repeat... 68 3e-09 emb|CBI31172.3| unnamed protein product [Vitis vinifera] 68 3e-09 ref|XP_010104766.1| hypothetical protein L484_021456 [Morus nota... 67 4e-09 ref|XP_002883423.1| pentatricopeptide repeat-containing protein ... 66 1e-08 ref|NP_188975.3| pentatricopeptide repeat-containing protein [Ar... 65 2e-08 ref|XP_010488389.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_010466660.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_010512381.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_006297059.1| hypothetical protein CARUB_v10013060mg [Caps... 65 2e-08 ref|XP_010532658.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_009376982.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_006406039.1| hypothetical protein EUTSA_v10020184mg [Eutr... 65 2e-08 ref|XP_009102629.1| PREDICTED: putative pentatricopeptide repeat... 65 3e-08 >ref|XP_011658262.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Cucumis sativus] gi|700194131|gb|KGN49335.1| hypothetical protein Csa_6G520330 [Cucumis sativus] Length = 771 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ F TI P L+WKS+IRCYTSHGL HQS+ SFIGM A G YPDH++ Sbjct: 55 LLHDSLRLFNTIHFPPALAWKSVIRCYTSHGLPHQSLGSFIGMLASGLYPDHNV 108 >ref|XP_008439708.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Cucumis melo] gi|307136183|gb|ADN34022.1| hypothetical protein [Cucumis melo subsp. melo] Length = 773 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ F T+ P L+WKS+IRCYTSHGL H+S+ SFIGM A G YPDH++ Sbjct: 57 LLHDSLRLFNTLHFPPALAWKSVIRCYTSHGLPHKSLGSFIGMLASGLYPDHNV 110 >ref|XP_010265006.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Nelumbo nucifera] gi|720028758|ref|XP_010265007.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Nelumbo nucifera] gi|720028762|ref|XP_010265008.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Nelumbo nucifera] gi|720028765|ref|XP_010265009.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Nelumbo nucifera] Length = 809 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = -2 Query: 169 GLLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 GLL+E+ F P +L+WKSIIRCYTS+GLF QS+ SF MRA GK PDH+I Sbjct: 55 GLLRESLFIFNAFPSPPSLAWKSIIRCYTSNGLFLQSLISFNEMRAAGKCPDHNI 109 >ref|XP_008224341.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Prunus mume] Length = 715 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDP-STLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ F T P +TL+WKSIIRCYTSHGL S+ASF+ M+AFG YPDH++ Sbjct: 54 LLHDSLTLFNTFHSPPTTLAWKSIIRCYTSHGLCRHSLASFVEMKAFGIYPDHNV 108 >ref|XP_007225005.1| hypothetical protein PRUPE_ppa020300mg [Prunus persica] gi|462421941|gb|EMJ26204.1| hypothetical protein PRUPE_ppa020300mg [Prunus persica] Length = 671 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDP-STLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ F T P +TL+WKSIIRCYTSHGL S+ASF+ M+AFG YPDH++ Sbjct: 54 LLHDSLTLFNTFHSPPTTLAWKSIIRCYTSHGLCRHSLASFVEMKAFGIYPDHNV 108 >ref|XP_010906775.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Elaeis guineensis] Length = 729 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -2 Query: 169 GLLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHIL 2 GLL EA F+++ P L+WKS+IRC TSHGLFHQS++ F+ MRA G PD +L Sbjct: 54 GLLHEALRAFSSLPSPPPLAWKSVIRCSTSHGLFHQSVSLFVQMRASGTPPDGDVL 109 >ref|XP_008360419.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Malus domestica] gi|658049456|ref|XP_008360421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Malus domestica] gi|658049458|ref|XP_008360422.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Malus domestica] Length = 779 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/55 (52%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPS-TLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL + F ++ P TL+WKS+IRCY SHGL+H+S+ASF+ M FG YPDH++ Sbjct: 57 LLHDTLTVFNSLPSPPPTLAWKSVIRCYASHGLYHRSLASFVEMMGFGIYPDHNV 111 >ref|XP_010653129.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398080|ref|XP_010653130.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398082|ref|XP_010653131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398084|ref|XP_010653132.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398086|ref|XP_010653133.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398088|ref|XP_010653134.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] gi|731398090|ref|XP_010653135.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] Length = 765 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDP-STLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ L F ++ P +TL+WKSIIRCYTSHGLF S++ FI M A GKYPDH++ Sbjct: 54 LLHDSLLIFNSLPSPPTTLAWKSIIRCYTSHGLFLHSLSFFIQMLASGKYPDHNV 108 >emb|CBI31172.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDP-STLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ L F ++ P +TL+WKSIIRCYTSHGLF S++ FI M A GKYPDH++ Sbjct: 54 LLHDSLLIFNSLPSPPTTLAWKSIIRCYTSHGLFLHSLSFFIQMLASGKYPDHNV 108 >ref|XP_010104766.1| hypothetical protein L484_021456 [Morus notabilis] gi|587914027|gb|EXC01816.1| hypothetical protein L484_021456 [Morus notabilis] Length = 709 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 L + + L F T+ P L+WKSIIR YTSHGLF QS+ SF+ MRAF YPDH+I Sbjct: 57 LFRYSLLLFQTLHSPPPLAWKSIIRSYTSHGLFLQSVTSFVRMRAFQIYPDHNI 110 >ref|XP_002883423.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329263|gb|EFH59682.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 679 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLVFKTLESPPVLAWKSVIRCFTDQSLFSRALASFVEMRASGRCPDHNV 107 >ref|NP_188975.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274454|sp|Q9LW63.1|PP251_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g23330 gi|11994318|dbj|BAB02277.1| unnamed protein product [Arabidopsis thaliana] gi|332643232|gb|AEE76753.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 715 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLLFKTLKSPPVLAWKSVIRCFTDQSLFSKALASFVEMRASGRCPDHNV 107 >ref|XP_010488389.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Camelina sativa] Length = 712 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLLFKTLESPPVLAWKSVIRCFTDQSLFSRALASFVEMRASGRCPDHNV 107 >ref|XP_010466660.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Camelina sativa] Length = 735 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 77 LLHEALLLFKTLESPPVLAWKSVIRCFTDQSLFSRALASFVEMRASGRCPDHNV 130 >ref|XP_010512381.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Camelina sativa] Length = 712 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLLFKTLESPPVLAWKSVIRCFTDQSLFFRALASFVEMRASGRCPDHNV 107 >ref|XP_006297059.1| hypothetical protein CARUB_v10013060mg [Capsella rubella] gi|482565768|gb|EOA29957.1| hypothetical protein CARUB_v10013060mg [Capsella rubella] Length = 730 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLLFKTLESPPVLAWKSVIRCFTDQSLFSRALASFVEMRASGRCPDHNV 107 >ref|XP_010532658.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Tarenaya hassleriana] Length = 747 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 L QEA L F + P L+WKSIIRC+TS GLF ++++SF+ M A G YPDH++ Sbjct: 54 LSQEALLLFQRVDSPPVLAWKSIIRCFTSQGLFARALSSFVEMLASGTYPDHNV 107 >ref|XP_009376982.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Pyrus x bretschneideri] Length = 779 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPS-TLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL ++ F ++ P TL+WKS+IRCY +HGL H+S+ASF+ M FG YPDH++ Sbjct: 57 LLHDSLTLFNSLPSPPPTLAWKSVIRCYAAHGLCHRSLASFVEMMGFGIYPDHNV 111 >ref|XP_006406039.1| hypothetical protein EUTSA_v10020184mg [Eutrema salsugineum] gi|557107185|gb|ESQ47492.1| hypothetical protein EUTSA_v10020184mg [Eutrema salsugineum] Length = 694 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF +++ASF+ MRA G+ PDH++ Sbjct: 54 LLHEALLLFHTLESPPVLAWKSVIRCFTDQSLFSRALASFVEMRASGRCPDHNV 107 >ref|XP_009102629.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Brassica rapa] Length = 713 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -2 Query: 166 LLQEAHLTFTTIVDPSTLSWKSIIRCYTSHGLFHQSIASFIGMRAFGKYPDHHI 5 LL EA L F T+ P L+WKS+IRC+T LF ++++SF+ MRA G+ PDH++ Sbjct: 57 LLHEALLLFRTLESPPVLAWKSVIRCFTDQSLFSRALSSFVDMRASGRCPDHNV 110