BLASTX nr result
ID: Cinnamomum24_contig00022519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00022519 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB20616.1| hypothetical protein B456_003G156400 [Gossypium r... 65 3e-08 gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 51 3e-08 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 gb|KJB20618.1| hypothetical protein B456_003G156600, partial [Go... 60 8e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 45 2e-06 gb|KOM37535.1| hypothetical protein LR48_Vigan03g091700 [Vigna a... 56 9e-06 >gb|KJB20616.1| hypothetical protein B456_003G156400 [Gossypium raimondii] Length = 127 Score = 64.7 bits (156), Expect = 3e-08 Identities = 39/87 (44%), Positives = 50/87 (57%), Gaps = 1/87 (1%) Frame = +1 Query: 49 LGQKLHRPVILPLSRVGGSRCSVRPAWRCALHFKGPGDLGFRPSHMAHYLAWNGRAS*AV 228 +G + +PVILPL R GG RCSV+PA R ALH + F S LAWNG+A Sbjct: 29 VGLERIKPVILPLLREGGLRCSVKPASRSALHLRNHETQSFHSSPSVQLLAWNGQAR-LG 87 Query: 229 PSPTPQTESTHP-HHLIALARVTSSCY 306 P+P P +++ HHL A +VTS Y Sbjct: 88 PTPDPILQASPMFHHLKAPTQVTSKRY 114 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 51.2 bits (121), Expect(2) = 3e-08 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 170 KPRSPGPLKWRAQRQAGLTEQRLPPTLDSGRITGRC 63 K R+ LKWRA R+AG TEQR PP SGRITGRC Sbjct: 87 KARATCVLKWRAPREAGFTEQRKPPAPGSGRITGRC 122 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = -3 Query: 306 VA*ACNSSEGYKVVWMS*LGLRGWARDCLAGSPIPSQVVSHVAWAKAQVSWPFK 145 VA AC+ S G KVV + + L+G P+PS+ + HV AKA+ + K Sbjct: 42 VARACDPSGGIKVVGRGLESIGPGLQRLLSGPPVPSRELIHVVRAKARATCVLK 95 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/76 (43%), Positives = 39/76 (51%) Frame = +1 Query: 64 HRPVILPLSRVGGSRCSVRPAWRCALHFKGPGDLGFRPSHMAHYLAWNGRAS*AVPSPTP 243 H+ VILPL R GG RCSV+PA RCAL + F H+A AWNGRA P Sbjct: 17 HQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQGRP 76 Query: 244 QTESTHPHHLIALARV 291 P L+ L R+ Sbjct: 77 TGPEQRPITLMPLLRL 92 >gb|KJB20618.1| hypothetical protein B456_003G156600, partial [Gossypium raimondii] Length = 96 Score = 59.7 bits (143), Expect = 8e-07 Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = +1 Query: 49 LGQKLHRPVILPLSRVGGSRCSVRPAWRCALHFKGPGDLGFRPSHMAHYLAWNGRAS*AV 228 +G + +PVILPL R GG RCSV+PA R LHF+ F S LAWNG+A Sbjct: 17 VGLERIKPVILPLLREGGLRCSVKPASRNTLHFRNHETQSFHSSPSVQLLAWNGQARFG- 75 Query: 229 PSPTPQTESTHP-HHLIA 279 P+P P +++ HHL A Sbjct: 76 PTPDPTLQASPMFHHLQA 93 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 Query: 147 KVEGTAPGWSHRAATTSHSRQWKDHGPV 64 + EGTA GW HRAA TS S QWKD+GPV Sbjct: 26 RAEGTALGWFHRAAITSLSWQWKDNGPV 53 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 217 WLAHSKPGSEPCGLGESPG 161 WLA SK +PCGLGE PG Sbjct: 3 WLARSKLRVDPCGLGEGPG 21 >gb|KOM37535.1| hypothetical protein LR48_Vigan03g091700 [Vigna angularis] Length = 101 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/56 (50%), Positives = 34/56 (60%) Frame = -1 Query: 182 WLGRKPRSPGPLKWRAQRQAGLTEQRLPPTLDSGRITGRCSFWPSAPQGLLYSDHH 15 W+ K LKWR QR+AG TEQ+ PP+ DSG ITGRC+ P P +Y D H Sbjct: 16 WVRAKAWVSRVLKWRTQREAGFTEQQKPPSPDSGGITGRCNHSPVCP---VYLDRH 68