BLASTX nr result
ID: Cinnamomum24_contig00022458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00022458 (236 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591400.1| cytochrome C oxidase subunit 5C [Medicago tr... 65 2e-08 gb|ACU15627.1| unknown [Glycine max] 65 2e-08 ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 65 2e-08 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 64 3e-08 gb|ACU15919.1| unknown [Glycine max] 64 3e-08 gb|AFK48388.1| unknown [Lotus japonicus] 64 4e-08 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 64 6e-08 gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] 63 8e-08 ref|XP_003625971.2| cytochrome C oxidase subunit 5C [Medicago tr... 63 8e-08 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 63 8e-08 gb|AFK47757.1| unknown [Medicago truncatula] 63 8e-08 ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein ... 63 1e-07 ref|XP_002880298.1| cytochrome c oxidase subunit VC family prote... 63 1e-07 ref|XP_002862722.1| cytochrome c oxidase subunit VC family prote... 63 1e-07 ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 62 1e-07 ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 62 1e-07 ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 62 1e-07 ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 62 1e-07 sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subun... 62 2e-07 ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 62 2e-07 >ref|XP_003591400.1| cytochrome C oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| cytochrome C oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEISVV DEE Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEISVVVDEE 64 >gb|ACU15627.1| unknown [Glycine max] Length = 76 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/69 (50%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -1 Query: 218 MNKEKPGPFTIYWKKVRSVLLLTKSKNVLALC-LCSPFIDLFSCYVQMAL*NVNEPTYSE 42 MN+ KPGP TIYWK+VR +LL S+NVL L + S + F + NVNEPTY E Sbjct: 1 MNRGKPGPSTIYWKRVRLLLLQRNSENVLVLLPMLSIYRLFFPVLYSIGSSNVNEPTYYE 60 Query: 41 VQNNKFLAL 15 ++ NKFL L Sbjct: 61 IEKNKFLEL 69 >ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Cicer arietinum] Length = 64 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEISV+A+EE Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEISVIAEEE 64 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] gi|734338021|gb|KHN08636.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] gi|947121012|gb|KRH69218.1| hypothetical protein GLYMA_02G012400 [Glycine max] Length = 64 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEISVVA+E+ Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|ACU15919.1| unknown [Glycine max] Length = 64 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEISVVA+E+ Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|AFK48388.1| unknown [Lotus japonicus] Length = 64 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEI VVA+EE Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEIGVVAEEE 64 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 [Helianthus annuus] gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTR FYDLLEKGEISVV DEE Sbjct: 35 KMHHWNEQRKTRAFYDLLEKGEISVVVDEE 64 >gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] Length = 64 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEI+VVA+E+ Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >ref|XP_003625971.2| cytochrome C oxidase subunit 5C [Medicago truncatula] gi|657380182|gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncatula] Length = 117 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTF+DLLEKGEISV+A+EE Sbjct: 88 KMHHWNEQRKTRTFHDLLEKGEISVIAEEE 117 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] gi|947083072|gb|KRH31793.1| hypothetical protein GLYMA_10G012800 [Glycine max] Length = 64 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLEKGEI+VVA+E+ Sbjct: 35 KMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >gb|AFK47757.1| unknown [Medicago truncatula] Length = 64 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTF+DLLEKGEISV+A+EE Sbjct: 35 KMHHWNEQRKTRTFHDLLEKGEISVIAEEE 64 >ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] gi|48427900|sp|O22912.1|CX5C1_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-1; AltName: Full=Cytochrome c oxidase polypeptide Vc-1 gi|2275216|gb|AAB63838.1| putative cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|17979511|gb|AAL50091.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|20147289|gb|AAM10358.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|330255740|gb|AEC10834.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] Length = 64 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLE+GEISVVA EE Sbjct: 35 KMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_002880298.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297326137|gb|EFH56557.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLE+GEISVVA EE Sbjct: 35 KMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_002862722.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297817580|ref|XP_002876673.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297308410|gb|EFH38980.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] gi|297322511|gb|EFH52932.1| cytochrome c oxidase subunit VC family protein [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLE+GEISVVA EE Sbjct: 35 KMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X3 [Glycine max] Length = 68 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTR FYDLLEK EISVVADEE Sbjct: 39 KMHHWNEQRKTRAFYDLLEKDEISVVADEE 68 >ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Glycine max] gi|947120014|gb|KRH68263.1| hypothetical protein GLYMA_03G219600 [Glycine max] Length = 95 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTR FYDLLEK EISVVADEE Sbjct: 66 KMHHWNEQRKTRAFYDLLEKDEISVVADEE 95 >ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X4 [Glycine max] gi|571446705|ref|XP_006577166.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X5 [Glycine max] Length = 64 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTR FYDLLEK EISVVADEE Sbjct: 35 KMHHWNEQRKTRAFYDLLEKDEISVVADEE 64 >ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Glycine max] gi|734370271|gb|KHN19213.1| Cytochrome c oxidase subunit 5C [Glycine soja] gi|947120015|gb|KRH68264.1| hypothetical protein GLYMA_03G219600 [Glycine max] Length = 103 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTR FYDLLEK EISVVADEE Sbjct: 74 KMHHWNEQRKTRAFYDLLEKDEISVVADEE 103 >sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|7340711|emb|CAB82954.1| cytochrome c oxidase subunit 5c-like protein [Arabidopsis thaliana] Length = 64 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADEE 145 KMHHWNEQRKTRTFYDLLE+GEI VVA EE Sbjct: 35 KMHHWNEQRKTRTFYDLLERGEIGVVASEE 64 >ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Fragaria vesca subsp. vesca] Length = 63 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 234 KMHHWNEQRKTRTFYDLLEKGEISVVADE 148 KMHHWNEQRK RTFYDLLEKGEISVVA+E Sbjct: 35 KMHHWNEQRKVRTFYDLLEKGEISVVAEE 63