BLASTX nr result
ID: Cinnamomum24_contig00022027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00022027 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012436872.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_010557955.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_004301012.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_007216378.1| hypothetical protein PRUPE_ppa020947mg [Prun... 68 2e-09 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 68 2e-09 ref|XP_008230158.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Caps... 68 3e-09 emb|CDP13497.1| unnamed protein product [Coffea canephora] 67 4e-09 gb|KDO61702.1| hypothetical protein CISIN_1g038542mg, partial [C... 67 4e-09 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_006476888.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 67 4e-09 ref|XP_012081524.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 gb|KDP29911.1| hypothetical protein JCGZ_18480 [Jatropha curcas] 67 5e-09 ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citr... 67 5e-09 ref|NP_196272.1| pentatricopeptide repeat-containing protein [Ar... 67 7e-09 >ref|XP_012436872.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Gossypium raimondii] gi|763781334|gb|KJB48405.1| hypothetical protein B456_008G067300 [Gossypium raimondii] Length = 622 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 +T GTTIRI+KNLR+C D HTVTKL+SKIY+ EIV R+ RFHH Sbjct: 566 RTKPGTTIRIIKNLRICEDCHTVTKLVSKIYDREIVMRDRTRFHH 610 >ref|XP_010557955.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Tarenaya hassleriana] Length = 627 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 K+ AG+T+RIVKNLRVC D HTVTKLISKIY +IV R+ +RFHH Sbjct: 571 KSKAGSTLRIVKNLRVCKDCHTVTKLISKIYQRDIVMRDRIRFHH 615 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -1 Query: 197 WIYAEQ*ILGFFHN*RKS*TKTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNW 18 W ++E+ +GF T GTTIRIVKNLRVC D H+ TKLIS++YN EI+ R+ Sbjct: 554 WQHSEKLAIGF------GLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDR 607 Query: 17 VRFHH 3 +R+HH Sbjct: 608 IRYHH 612 >ref|XP_004301012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 704 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 +T GTT+RI KNLRVC D H TK+ISK+YN EI+ R+W RFHH Sbjct: 648 RTRPGTTLRISKNLRVCTDCHNATKIISKVYNREIIVRDWNRFHH 692 >ref|XP_007216378.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica] gi|462412528|gb|EMJ17577.1| hypothetical protein PRUPE_ppa020947mg [Prunus persica] Length = 710 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -1 Query: 134 TGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 TG GTTIRI KNLRVCND HTVTK+IS++ N EIV R+ RFHH Sbjct: 655 TGPGTTIRITKNLRVCNDCHTVTKMISELMNREIVMRDIHRFHH 698 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 [Vitis vinifera] Length = 672 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -1 Query: 197 WIYAEQ*ILGFFHN*RKS*TKTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNW 18 W ++E+ +GF T GTTIRIVKNLRVC D H+ TKLIS++YN EI+ R+ Sbjct: 602 WQHSEKLAIGF------GLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDR 655 Query: 17 VRFHH 3 +R+HH Sbjct: 656 IRYHH 660 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/65 (50%), Positives = 44/65 (67%) Frame = -1 Query: 197 WIYAEQ*ILGFFHN*RKS*TKTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNW 18 W ++E+ +GF T GTTIRIVKNLRVC D H+ TKLIS++YN EI+ R+ Sbjct: 603 WQHSEKLAIGF------GLINTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDR 656 Query: 17 VRFHH 3 +R+HH Sbjct: 657 IRYHH 661 >ref|XP_008230158.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Prunus mume] Length = 643 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 134 TGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 TG GTTIRI KNLRVCND HTVTK+IS++ N EI+ R+ RFHH Sbjct: 588 TGPGTTIRITKNLRVCNDCHTVTKMISELMNREIIMRDIHRFHH 631 >ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] gi|482558025|gb|EOA22217.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] Length = 622 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT AGTTIRIVKNLRVC D HTVTKLIS++Y E + R+ RFHH Sbjct: 566 KTKAGTTIRIVKNLRVCEDCHTVTKLISEVYGREFIVRDRNRFHH 610 >emb|CDP13497.1| unnamed protein product [Coffea canephora] Length = 608 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GT+IRIVKNLRVC D HT TK ISKIYN EIV R+ RFHH Sbjct: 552 KTPPGTSIRIVKNLRVCEDCHTATKFISKIYNREIVVRDRNRFHH 596 >gb|KDO61702.1| hypothetical protein CISIN_1g038542mg, partial [Citrus sinensis] Length = 475 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GT IRIVKNLRVCND H+ TK ISKIYN EIV R+ RFHH Sbjct: 428 KTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 472 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GTTIRI KNLRVC D H+ TKLISKIYN EI+ R+ RFHH Sbjct: 444 KTDPGTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHH 488 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GT IRIVKNLRVCND H+ TK ISKIYN EIV R+ RFHH Sbjct: 510 KTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 554 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GT IRIVKNLRVCND H+ TK ISKIYN EIV R+ RFHH Sbjct: 544 KTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 588 >ref|XP_006476888.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 695 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 +T GT IRI KNLRVC D H TK+ISK++N EIV R+W RFHH Sbjct: 639 RTSPGTPIRISKNLRVCTDCHNATKIISKVFNREIVVRDWTRFHH 683 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GT IRIVKNLRVCND H+ TK ISKIYN EIV R+ RFHH Sbjct: 573 KTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 617 >ref|XP_012081524.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Jatropha curcas] Length = 674 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 131 GAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 G+G+ IRI+KNLRVCND HTVTKL+SKIY+ EI+ R+ RFHH Sbjct: 620 GSGSPIRIIKNLRVCNDCHTVTKLLSKIYSREIIVRDNSRFHH 662 >gb|KDP29911.1| hypothetical protein JCGZ_18480 [Jatropha curcas] Length = 247 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 131 GAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 G+G+ IRI+KNLRVCND HTVTKL+SKIY+ EI+ R+ RFHH Sbjct: 193 GSGSPIRIIKNLRVCNDCHTVTKLLSKIYSREIIVRDNSRFHH 235 >ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] gi|568824869|ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557527644|gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] Length = 622 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT G TIRI+KNLRVC D HTV KLISKIY+ EIV R+ RFHH Sbjct: 566 KTEPGVTIRIIKNLRVCEDCHTVMKLISKIYDREIVMRDRTRFHH 610 >ref|NP_196272.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170345|sp|Q9FG16.1|PP367_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g06540 gi|10178110|dbj|BAB11403.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332003649|gb|AED91032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 622 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 KTGAGTTIRIVKNLRVCNDYHTVTKLISKIYNLEIVFRNWVRFHH 3 KT GTTIRIVKNLRVC D HTVTKLIS++Y E++ R+ RFHH Sbjct: 566 KTKPGTTIRIVKNLRVCEDCHTVTKLISEVYGRELIVRDRNRFHH 610