BLASTX nr result
ID: Cinnamomum24_contig00021301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021301 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium r... 69 1e-09 >gb|KJB09784.1| hypothetical protein B456_001G165700 [Gossypium raimondii] Length = 134 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 230 VLRCTHSRYENEMTPQLDSRPRLLTYRTNSGTER 129 VLRCTHSRYENEMTPQLDSRPRLLT RTNSG ER Sbjct: 72 VLRCTHSRYENEMTPQLDSRPRLLTTRTNSGAER 105