BLASTX nr result
ID: Cinnamomum24_contig00021276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021276 (202 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245632.1| PREDICTED: thaumatin-like protein [Solanum l... 100 3e-19 ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptu... 100 6e-19 ref|XP_009772655.1| PREDICTED: thaumatin-like protein [Nicotiana... 99 1e-18 gb|AAD55090.1| thaumatin [Vitis riparia] 99 1e-18 gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] 99 1e-18 ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] 99 2e-18 gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus g... 99 2e-18 gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus g... 99 2e-18 ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptu... 99 2e-18 gb|KCW61089.1| hypothetical protein EUGRSUZ_H03863 [Eucalyptus g... 99 2e-18 ref|XP_010906392.1| PREDICTED: thaumatin-like protein [Elaeis gu... 98 2e-18 ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein,... 98 3e-18 gb|AJR20992.1| thaumatin-like protein/pathogenesis related prote... 97 4e-18 ref|XP_009609047.1| PREDICTED: protein P21-like [Nicotiana tomen... 97 4e-18 ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x b... 97 4e-18 ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prun... 97 4e-18 gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] 97 4e-18 gb|ADO32898.1| thaumatin-like protein [Vincetoxicum mongolicum] 97 4e-18 ref|XP_010906440.1| PREDICTED: thaumatin-like protein [Elaeis gu... 97 5e-18 pdb|4L2J|A Chain A, Crystal Structure Of Osmotin, An Antifungal ... 97 5e-18 >ref|XP_004245632.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum] Length = 220 Score = 100 bits (250), Expect = 3e-19 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP K+ +FFK+RCPDAYSYP+DD+TS FTCP+G NYRVVFCP Sbjct: 171 YCCNSGNCGPTKFSRFFKERCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP 220 >ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|702513212|ref|XP_010041217.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|629075933|gb|KCW44533.1| hypothetical protein EUGRSUZ_L01962 [Eucalyptus grandis] gi|629095095|gb|KCW61090.1| hypothetical protein EUGRSUZ_H03864 [Eucalyptus grandis] Length = 225 Score = 100 bits (248), Expect = 6e-19 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCPSG NYRVVFCP Sbjct: 176 YCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPSGTNYRVVFCP 225 >ref|XP_009772655.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris] Length = 220 Score = 99.0 bits (245), Expect = 1e-18 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + +FFKQRCPDAYSYP+DD+TS FTCP+G NY+VVFCP Sbjct: 171 YCCNSGNCGPTNFSRFFKQRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 220 >gb|AAD55090.1| thaumatin [Vitis riparia] Length = 247 Score = 99.0 bits (245), Expect = 1e-18 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCPTG 45 YCCN+ +CGP Y +FFK RCPDAYSYPQDD TS FTCP G NYRVVFCPTG Sbjct: 179 YCCNNIKCGPTDYSRFFKTRCPDAYSYPQDDPTSTFTCPGGANYRVVFCPTG 230 >gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] Length = 225 Score = 99.0 bits (245), Expect = 1e-18 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + +FFKQRCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 176 YCCNSGTCGPTDFSRFFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] Length = 226 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP+G NYRVVFCP Sbjct: 177 YCCNSGSCGPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus grandis] Length = 225 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 176 YCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus grandis] Length = 225 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 176 YCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|629095096|gb|KCW61091.1| hypothetical protein EUGRSUZ_H03865 [Eucalyptus grandis] Length = 225 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 176 YCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >gb|KCW61089.1| hypothetical protein EUGRSUZ_H03863 [Eucalyptus grandis] Length = 212 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 163 YCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 212 >ref|XP_010906392.1| PREDICTED: thaumatin-like protein [Elaeis guineensis] Length = 164 Score = 98.2 bits (243), Expect = 2e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP Y KFFK RCPDAYSYP+DD+TS FTCP G NY+V+FCP Sbjct: 115 YCCNSGGCGPTNYSKFFKNRCPDAYSYPKDDQTSTFTCPGGTNYKVIFCP 164 >ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] gi|508728506|gb|EOY20403.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] Length = 245 Score = 97.8 bits (242), Expect = 3e-18 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG C P Y KFFK RCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 196 YCCNSGNCSPTDYSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 245 >gb|AJR20992.1| thaumatin-like protein/pathogenesis related protein-5 [Populus szechuanica] Length = 225 Score = 97.4 bits (241), Expect = 4e-18 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG C P Y +FFKQRCPDAYSYP+DD+TS FTCP G NYRVVFCP Sbjct: 176 YCCNSGSCEPTDYSRFFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_009609047.1| PREDICTED: protein P21-like [Nicotiana tomentosiformis] Length = 232 Score = 97.4 bits (241), Expect = 4e-18 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP ++ K+FK +CPDAYSYP+DD+TS FTCP+G NYRVVFCP Sbjct: 183 YCCNSGNCGPTEFSKYFKDKCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 232 >ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri] Length = 225 Score = 97.4 bits (241), Expect = 4e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + KFFK RCPDAYSYP+DD+TS FTCP G NY+VVFCP Sbjct: 176 YCCNSGNCGPTDFSKFFKSRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225 >ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica] gi|462406324|gb|EMJ11788.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica] Length = 226 Score = 97.4 bits (241), Expect = 4e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP + +FFK RCPDAYSYP+DD+TS FTCP+G NYRVVFCP Sbjct: 177 YCCNSGSCGPTDFSRFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] Length = 225 Score = 97.4 bits (241), Expect = 4e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP Y +FFK RCPDAYSYP+DD+TS FTCP G NY+VVFCP Sbjct: 176 YCCNSGNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225 >gb|ADO32898.1| thaumatin-like protein [Vincetoxicum mongolicum] Length = 225 Score = 97.4 bits (241), Expect = 4e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSGRC P + FFK+RCPDAYSYP+DD+TS FTCP+G NYRVVFCP Sbjct: 176 YCCNSGRCSPTNFSSFFKKRCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP 225 >ref|XP_010906440.1| PREDICTED: thaumatin-like protein [Elaeis guineensis] Length = 184 Score = 97.1 bits (240), Expect = 5e-18 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCP 51 YCCNSG CGP Y +FFK+RCPDAYSYP+DD+TS FTCP G NY+V FCP Sbjct: 135 YCCNSGSCGPTNYSRFFKERCPDAYSYPKDDQTSTFTCPGGTNYKVTFCP 184 >pdb|4L2J|A Chain A, Crystal Structure Of Osmotin, An Antifungal Laticifer Protein Length = 206 Score = 97.1 bits (240), Expect = 5e-18 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = -3 Query: 200 YCCNSGRCGPNKYFKFFKQRCPDAYSYPQDDRTSPFTCPSGVNYRVVFCPTG 45 YCCNSG CGP Y +FFK+RC DAYSYP+DD TS FTCPSG NYRV+FCP G Sbjct: 155 YCCNSGSCGPTTYSRFFKERCWDAYSYPKDDPTSTFTCPSGTNYRVIFCPPG 206