BLASTX nr result
ID: Cinnamomum24_contig00021261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021261 (461 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048818.1| Uncharacterized protein TCM_001832 [Theobrom... 40 5e-06 >ref|XP_007048818.1| Uncharacterized protein TCM_001832 [Theobroma cacao] gi|508701079|gb|EOX92975.1| Uncharacterized protein TCM_001832 [Theobroma cacao] Length = 182 Score = 40.0 bits (92), Expect(2) = 5e-06 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = -2 Query: 346 SCPPDGMLKFNIDGAARGKPGPKSICGFVQRNKSLVVFMF 227 S PP G KFN+D +A+GKPGP G ++ + VV +F Sbjct: 38 SPPPTGEFKFNVDNSAKGKPGPVGCNGVLRDSNGHVVGLF 77 Score = 37.0 bits (84), Expect(2) = 5e-06 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = -3 Query: 231 CL*SMHESNI*MI*KCLLVLEAFRIYC--PI*HQGLVVDSYSSSVISLMTFLEKAPWKFQ 58 CL +H+SNI + + +L+A +++ P L+++S S +S + +EK PW Sbjct: 79 CLIGLHDSNIAEL---MAILKALKLFAASPYTSSPLIIESDSRVALSWVNSVEKRPWDKW 135 Query: 57 FLFNEIKSMS-SSECVAFQH 1 + NE+ S+ + V+F+H Sbjct: 136 SILNELNSLRITLGTVSFKH 155