BLASTX nr result
ID: Cinnamomum24_contig00021107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021107 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrio... 115 8e-24 >ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] gi|403311585|gb|AFR34333.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] Length = 104 Score = 115 bits (287), Expect(2) = 8e-24 Identities = 56/65 (86%), Positives = 59/65 (90%) Frame = -1 Query: 205 KRDSIQIRHSLGDAFFSMNTPPLNDELCQSSPPTRPGENTRSSRALTCLN*IHISFVWSR 26 +RDSIQI HSLGDA FSMNTPPLNDELCQSSPPTRPGENT SS+ALT N IHISFVWSR Sbjct: 29 ERDSIQICHSLGDALFSMNTPPLNDELCQSSPPTRPGENTESSQALTRQNGIHISFVWSR 88 Query: 25 REKAR 11 REKA+ Sbjct: 89 REKAQ 93 Score = 21.9 bits (45), Expect(2) = 8e-24 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 261 LLFLDERDSIQI 226 +LFL ERDSIQI Sbjct: 24 VLFLYERDSIQI 35