BLASTX nr result
ID: Cinnamomum24_contig00021099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021099 (531 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phas... 59 1e-06 ref|XP_009611941.1| PREDICTED: putative cyclic nucleotide-gated ... 58 2e-06 emb|CBI16330.3| unnamed protein product [Vitis vinifera] 57 5e-06 ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ... 57 5e-06 emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] 57 5e-06 ref|XP_010253719.1| PREDICTED: putative cyclic nucleotide-gated ... 56 9e-06 >ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] gi|561023451|gb|ESW22181.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] Length = 696 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = -2 Query: 161 MASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPE----SAPKKVDG 12 MA GNSR RF+DD E+A F A DN FK+ Y IDGTQIPE A KKV G Sbjct: 1 MAFGNSRSARFEDDPELAKFPASNGDNGFKIKYHIDGTQIPEPSSKMAKKKVTG 54 >ref|XP_009611941.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana tomentosiformis] Length = 710 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 161 MASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPESAPKK 21 MA GNSR VRFQDDLE FA DN K+ Y IDG+Q+PE A +K Sbjct: 1 MAYGNSRSVRFQDDLESTKFATINGDNLIKVKYKIDGSQLPELANRK 47 >emb|CBI16330.3| unnamed protein product [Vitis vinifera] Length = 697 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 161 MASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPESAPKK 21 MA NSR V+FQDDLE+A F A D K K+ Y IDGTQI E++ KK Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYKK 47 >ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Vitis vinifera] gi|731392688|ref|XP_010651183.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Vitis vinifera] Length = 713 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 161 MASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPESAPKK 21 MA NSR V+FQDDLE+A F A D K K+ Y IDGTQI E++ KK Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYKK 47 >emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] Length = 650 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 161 MASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPESAPKK 21 MA NSR V+FQDDLE+A F A D K K+ Y IDGTQI E++ KK Sbjct: 1 MAYENSRSVKFQDDLELAKFPATNGDGKIKMKYKIDGTQIQEASYKK 47 >ref|XP_010253719.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nelumbo nucifera] gi|719992914|ref|XP_010253720.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nelumbo nucifera] Length = 725 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -2 Query: 173 IRRTMASGNSRPVRFQDDLEVASFAACKADNKFKLTYMIDGTQIPESAPKKVD 15 ++ TM GNSR VRFQDD EVA K + KL Y IDGTQIPE++ +K + Sbjct: 9 LQSTMTYGNSRSVRFQDDPEVAKSTPSKGGHVIKLMYKIDGTQIPETSFRKAE 61