BLASTX nr result
ID: Cinnamomum24_contig00021044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00021044 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241113.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 ref|XP_009782932.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_009601888.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_010326506.1| PREDICTED: pentatricopeptide repeat-containi... 98 3e-18 ref|XP_006356764.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_008789574.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_004488287.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 emb|CDP03861.1| unnamed protein product [Coffea canephora] 82 2e-13 ref|XP_010905841.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_010905833.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_010548930.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 gb|KNA17135.1| hypothetical protein SOVF_082980 [Spinacia oleracea] 75 2e-11 ref|XP_012452895.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 ref|XP_006472722.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_008240346.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_013463792.1| pentatricopeptide (PPR) repeat protein [Medi... 73 7e-11 gb|KDO80743.1| hypothetical protein CISIN_1g0059432mg, partial [... 73 7e-11 ref|XP_006434131.1| hypothetical protein CICLE_v10000478mg [Citr... 73 7e-11 ref|XP_009616397.1| PREDICTED: putative pentatricopeptide repeat... 72 1e-10 ref|XP_006878551.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 >ref|XP_010241113.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nelumbo nucifera] Length = 697 Score = 113 bits (283), Expect = 5e-23 Identities = 57/99 (57%), Positives = 75/99 (75%), Gaps = 1/99 (1%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISA 115 M +HARF+KLG+DT+P++ATRLLNAY +TS P SL A ++FDQV KDTVLW+S+IS Sbjct: 1 MNTHARFIKLGIDTNPIVATRLLNAY-ATSYMPDSLCYAQRLFDQVYFKDTVLWSSIISV 59 Query: 114 YTQSTIPNHALQLFSQMHAQSQ-TKPNHFTFTSVARACG 1 YT+ + ALQLF+QM Q+ +PNHF + + ARACG Sbjct: 60 YTRLGNSHKALQLFAQMKLQTHPIQPNHFIYATAARACG 98 >ref|XP_009782932.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana sylvestris] Length = 696 Score = 106 bits (264), Expect = 8e-21 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 4/100 (4%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISA 115 M HA F+KLGLDT PV AT+L+ Y + + P S++ AHQ+FDQV KDT LWTS+ISA Sbjct: 1 MSRHAWFIKLGLDTSPVYATKLVADYVISGI-PNSISIAHQLFDQVPQKDTPLWTSIISA 59 Query: 114 YTQSTIPNHALQLFSQMHAQSQT----KPNHFTFTSVARA 7 Y +S P+ AL LFS M QSQ+ +PNHF FT+VARA Sbjct: 60 YARSNQPHKALHLFSCMLHQSQSNPDARPNHFVFTAVARA 99 >ref|XP_009601888.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nicotiana tomentosiformis] Length = 696 Score = 105 bits (262), Expect = 1e-20 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 4/100 (4%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISA 115 M HA F+KLGLDT PV AT+L+ Y + + P S++ AHQ+FDQV KDT LWTS+ISA Sbjct: 1 MSRHAWFIKLGLDTSPVYATKLIADYVISGI-PNSISIAHQVFDQVPQKDTPLWTSIISA 59 Query: 114 YTQSTIPNHALQLFSQMHAQSQT----KPNHFTFTSVARA 7 Y +S P+ AL LFS M QSQ+ +PNHF FT+VARA Sbjct: 60 YARSKKPHKALHLFSCMLHQSQSNPDAQPNHFVFTAVARA 99 >ref|XP_010326506.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Solanum lycopersicum] Length = 744 Score = 97.8 bits (242), Expect = 3e-18 Identities = 54/102 (52%), Positives = 68/102 (66%), Gaps = 6/102 (5%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISA 115 M HA +KLGLDT P+ AT L+ Y +++ P SL AH++FDQV KDT LWTSLIS+ Sbjct: 1 MSKHAWLIKLGLDTCPLYATNLIAHYVFSAI-PNSLTIAHKVFDQVPHKDTTLWTSLISS 59 Query: 114 YTQSTIPNHALQLFSQMHAQSQTK------PNHFTFTSVARA 7 Y +S P+ AL LFS M QSQ+ PNHF F++VARA Sbjct: 60 YARSNQPHKALHLFSLMLHQSQSNPDTAAHPNHFVFSTVARA 101 >ref|XP_006356764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum tuberosum] Length = 699 Score = 97.1 bits (240), Expect = 5e-18 Identities = 54/102 (52%), Positives = 67/102 (65%), Gaps = 6/102 (5%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISA 115 M HA +KLGLDT P+ AT L+ Y S+ + P SL A ++FDQV KDT LWTSLIS+ Sbjct: 1 MSKHAWLIKLGLDTSPLYATNLIAHYVSSPI-PNSLTIAQKVFDQVPHKDTTLWTSLISS 59 Query: 114 YTQSTIPNHALQLFSQMHAQSQT------KPNHFTFTSVARA 7 Y +S P+ AL LFS M Q Q+ +PNHF FT+VARA Sbjct: 60 YARSNQPHKALHLFSVMLNQYQSNPDTAAQPNHFVFTAVARA 101 >ref|XP_008789574.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Phoenix dactylifera] Length = 698 Score = 84.0 bits (206), Expect = 4e-14 Identities = 51/95 (53%), Positives = 63/95 (66%), Gaps = 2/95 (2%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQV--SSKDTVLWTSLISAY 112 HAR LKLGLD DPV AT+LL AY S SP SL A ++F QV S+D VLWT+L+SA+ Sbjct: 5 HARLLKLGLDRDPVTATQLLTAYASLP-SPDSLTYALRLFAQVPSRSRDPVLWTALLSAF 63 Query: 111 TQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARA 7 +ST P AL+LFS++ + N F F S ARA Sbjct: 64 ARSTRPAAALRLFSRL---PSLRSNPFAFASAARA 95 >ref|XP_004488287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] gi|502086668|ref|XP_004488288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] gi|502086671|ref|XP_004488289.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] Length = 612 Score = 82.8 bits (203), Expect = 9e-14 Identities = 46/103 (44%), Positives = 62/103 (60%) Frame = -2 Query: 312 SSFLT*MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLW 133 SSFL HA +K GL +D + LL Y S P L+ A ++FD +S KD + W Sbjct: 66 SSFLHGTSVHAHVIKSGLHSDRFVGNSLLTLYFKLSPGP-HLSQARKLFDSLSIKDVISW 124 Query: 132 TSLISAYTQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 TSLIS YT++ +P H+L LF+QM A +PN FT +SV +AC Sbjct: 125 TSLISGYTRAGLPRHSLSLFNQMLA-FPIQPNAFTLSSVIKAC 166 >emb|CDP03861.1| unnamed protein product [Coffea canephora] Length = 697 Score = 82.0 bits (201), Expect = 2e-13 Identities = 48/102 (47%), Positives = 66/102 (64%), Gaps = 6/102 (5%) Frame = -2 Query: 294 MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSS--KDTVLWTSLI 121 M HA +KLGLD++P+ A++L+ Y SP+SL++AH++FDQV +DT LW SLI Sbjct: 1 MNRHAGLIKLGLDSNPIHASKLIAEYARFP-SPSSLSHAHRVFDQVPFYLQDTPLWASLI 59 Query: 120 SAYTQSTIPNHALQLFSQM----HAQSQTKPNHFTFTSVARA 7 S Y++S P++AL LF M A S PN + F SVARA Sbjct: 60 SLYSRSHQPHNALHLFFHMLRPPQAASNALPNTYVFASVARA 101 >ref|XP_010905841.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X2 [Elaeis guineensis] Length = 652 Score = 75.9 bits (185), Expect = 1e-11 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 2/95 (2%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQV--SSKDTVLWTSLISAY 112 HAR LKLGLD +PV AT+LL AY S S SL A ++F QV S+D VLWT+L+SA+ Sbjct: 5 HARLLKLGLDREPVKATQLLTAYASLP-SADSLTCALRLFAQVPSRSRDPVLWTALLSAF 63 Query: 111 TQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARA 7 +S P A++LFS++ + N F F S ARA Sbjct: 64 ARSARPTAAVRLFSRL---PSIRSNPFAFASAARA 95 >ref|XP_010905833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869530|ref|XP_010905834.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869534|ref|XP_010905835.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869538|ref|XP_010905836.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869542|ref|XP_010905837.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869546|ref|XP_010905838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869550|ref|XP_010905839.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] gi|743869554|ref|XP_010905840.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Elaeis guineensis] Length = 701 Score = 75.9 bits (185), Expect = 1e-11 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 2/95 (2%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQV--SSKDTVLWTSLISAY 112 HAR LKLGLD +PV AT+LL AY S S SL A ++F QV S+D VLWT+L+SA+ Sbjct: 5 HARLLKLGLDREPVKATQLLTAYASLP-SADSLTCALRLFAQVPSRSRDPVLWTALLSAF 63 Query: 111 TQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARA 7 +S P A++LFS++ + N F F S ARA Sbjct: 64 ARSARPTAAVRLFSRL---PSIRSNPFAFASAARA 95 >ref|XP_010548930.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720 [Tarenaya hassleriana] Length = 599 Score = 75.9 bits (185), Expect = 1e-11 Identities = 40/94 (42%), Positives = 53/94 (56%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 HA+ LKLGL D V T L+N Y + T +A Q+ D++ + V WTS+IS Y Sbjct: 40 HAQILKLGLVNDTVTTTHLINGYVR--IRETDIAR--QLLDEMPEPNVVSWTSVISGYND 95 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 P AL LF +MH ++ PN FTF SV +AC Sbjct: 96 VGRPKMALMLFQKMHEENSVLPNEFTFASVVKAC 129 >gb|KNA17135.1| hypothetical protein SOVF_082980 [Spinacia oleracea] Length = 534 Score = 75.1 bits (183), Expect = 2e-11 Identities = 43/114 (37%), Positives = 67/114 (58%) Frame = -2 Query: 345 LPPDLDRTRSKSSFLT*MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMF 166 LP L T +S ++HA+ LK GL D A+RL+ A+ T+ +P ++A AH +F Sbjct: 8 LPAILSFTEKATSLTEIQQAHAQLLKTGLVNDTFTASRLV-AFAYTNPNPQTVAYAHSIF 66 Query: 165 DQVSSKDTVLWTSLISAYTQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 Q+S+ ++ W S+I AY S P +AL LF+QM S +P+ +T T + +AC Sbjct: 67 SQLSNPNSFTWNSMIRAYANSPNPQNALHLFTQMLGTS-VEPDKYTSTFLIKAC 119 >ref|XP_012452895.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium raimondii] gi|823240575|ref|XP_012452896.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g64310 [Gossypium raimondii] gi|763799615|gb|KJB66570.1| hypothetical protein B456_010G143900 [Gossypium raimondii] Length = 552 Score = 74.3 bits (181), Expect = 3e-11 Identities = 41/94 (43%), Positives = 54/94 (57%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 HA K L DP AT+LL Y L +A +FD+ + LW S+I AY Q Sbjct: 26 HALISKTHLSLDPFFATKLLRFYAINH----DLCSARNLFDKAPQRSVFLWNSIIRAYAQ 81 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 + NH+L LF+QM A S+TKP++FT+ SV RAC Sbjct: 82 AHHFNHSLSLFNQMLA-SETKPDNFTYASVTRAC 114 >ref|XP_006472722.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210-like [Citrus sinensis] Length = 692 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/94 (37%), Positives = 57/94 (60%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 H R +K GL D LL+ Y TSL +AH++FD+++ K+ V WT++++AYT Sbjct: 26 HCRIIKYGLSQDIFTGNNLLSMYADF----TSLNDAHKLFDEMARKNIVSWTTMVTAYTS 81 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 S PN A++L++ M +PN F +++V +AC Sbjct: 82 SKRPNWAIRLYNHMLEYGSVEPNGFMYSAVLKAC 115 >ref|XP_008240346.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Prunus mume] Length = 586 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/94 (38%), Positives = 50/94 (53%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 HA+ +K L P + LLN Y L+N Q+FD++ K+ V W+++I+ + Q Sbjct: 54 HAKLIKGSLPFSPFLQNHLLNMYAKCG----DLSNGLQLFDEMPHKNVVSWSAVITGFVQ 109 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 P AL LF +MH S TKPN FT S AC Sbjct: 110 HGCPKEALSLFGRMHQDSTTKPNEFTLVSALHAC 143 >ref|XP_013463792.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657398214|gb|KEH37827.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 625 Score = 73.2 bits (178), Expect = 7e-11 Identities = 39/94 (41%), Positives = 56/94 (59%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 HA LK GL +D + LL Y + P L++A +FD + KD + WTSLIS YT+ Sbjct: 73 HAHVLKSGLHSDRFVGNSLLTLYFKLNPGP-HLSHARHLFDSLHVKDVISWTSLISGYTR 131 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 S +P+ ++ LF +M A +PN FT +SV +AC Sbjct: 132 SDLPHQSISLFYEMLA-FPVQPNAFTLSSVIKAC 164 >gb|KDO80743.1| hypothetical protein CISIN_1g0059432mg, partial [Citrus sinensis] Length = 156 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/94 (36%), Positives = 57/94 (60%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 H R +K GL D LL+ Y TSL +AH++FD+++ K+ V WT++++AYT Sbjct: 26 HCRIIKYGLSQDIFTGNNLLSMYADF----TSLNDAHKLFDEMARKNIVSWTTMVTAYTS 81 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 + PN A++L++ M +PN F +++V +AC Sbjct: 82 NKRPNWAIRLYNHMLEYGSVEPNGFMYSAVLKAC 115 >ref|XP_006434131.1| hypothetical protein CICLE_v10000478mg [Citrus clementina] gi|557536253|gb|ESR47371.1| hypothetical protein CICLE_v10000478mg [Citrus clementina] Length = 692 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/94 (36%), Positives = 57/94 (60%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 H R +K GL D LL+ Y TSL +AH++FD+++ K+ V WT++++AYT Sbjct: 26 HCRIIKYGLSQDIFTGNNLLSMYADF----TSLNDAHKLFDEMARKNIVSWTTMVTAYTS 81 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 + PN A++L++ M +PN F +++V +AC Sbjct: 82 NKRPNWAIRLYNHMLEYGSVEPNGFMYSAVLKAC 115 >ref|XP_009616397.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400 [Nicotiana tomentosiformis] Length = 426 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/104 (34%), Positives = 63/104 (60%) Frame = -2 Query: 315 KSSFLT*MKSHARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVL 136 KS + ++H+ +KLG + + + T L++ Y +T+ ++A+ HQ+FD++ +K+ V Sbjct: 76 KSMAIEGKQAHSLLIKLGYEPNIFLQTSLMDMYATTA----NVADVHQVFDEIPNKNVVC 131 Query: 135 WTSLISAYTQSTIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 WTSLIS+Y Q+ PN A ++F +M +P+ TFT AC Sbjct: 132 WTSLISSYVQNQKPNRATEIFRKMQ-MDDVEPDQVTFTVALSAC 174 >ref|XP_006878551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Amborella trichopoda] gi|548831894|gb|ERM94696.1| hypothetical protein AMTR_s00011p00233950 [Amborella trichopoda] Length = 607 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/94 (37%), Positives = 53/94 (56%) Frame = -2 Query: 285 HARFLKLGLDTDPVIATRLLNAYTSTSLSPTSLANAHQMFDQVSSKDTVLWTSLISAYTQ 106 HA + GL++D ++ + L + Y S+ A +FD++ +DTV WT++I Y Q Sbjct: 274 HAHITRTGLESDAIVWSALSDMYAKCG----SITEARYVFDRILERDTVAWTTMIGRYVQ 329 Query: 105 STIPNHALQLFSQMHAQSQTKPNHFTFTSVARAC 4 + + ALQLF +M Q +KPN FTF V AC Sbjct: 330 AGQASEALQLFYEMVKQGDSKPNEFTFVGVLSAC 363