BLASTX nr result
ID: Cinnamomum24_contig00020659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00020659 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010668088.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_010537812.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008441211.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_010265649.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_002316152.1| pentatricopeptide repeat-containing family p... 65 2e-08 ref|XP_011014127.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_012078463.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] g... 64 3e-08 ref|XP_002532083.1| pentatricopeptide repeat-containing protein,... 64 6e-08 ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Caps... 64 6e-08 ref|NP_178067.1| pentatricopeptide repeat-containing protein [Ar... 63 8e-08 ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutr... 63 8e-08 ref|XP_010417611.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010025649.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012456038.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containi... 58 6e-07 gb|KCW62354.1| hypothetical protein EUGRSUZ_H04993 [Eucalyptus g... 60 8e-07 >ref|XP_010668088.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870840772|gb|KMS94906.1| hypothetical protein BVRB_014230 [Beta vulgaris subsp. vulgaris] Length = 818 Score = 69.3 bits (168), Expect = 1e-09 Identities = 38/70 (54%), Positives = 45/70 (64%) Frame = -3 Query: 211 FSPIPVTPNSFWLFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGK 32 F PIPV +S +F S + N R F SEK +SEWTD+I YLDE G V++SGK Sbjct: 44 FRPIPVHLSSNSIFHS---VKNPKFARSFCSEKP---NASEWTDEIEYLDEKGSVLYSGK 97 Query: 31 GIRSVEPGLD 2 GIRSVEPG D Sbjct: 98 GIRSVEPGFD 107 >ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Cucumis sativus] gi|700207976|gb|KGN63095.1| hypothetical protein Csa_2G402030 [Cucumis sativus] Length = 823 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -3 Query: 151 NNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 NN R + S K +G EWT+DI YLDESG VIFSGKG+RSVEPG+D Sbjct: 63 NNRSFTRSYCSGKESGNGGREWTEDIEYLDESGSVIFSGKGVRSVEPGVD 112 >ref|XP_010537812.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Tarenaya hassleriana] Length = 833 Score = 67.8 bits (164), Expect = 3e-09 Identities = 40/100 (40%), Positives = 55/100 (55%) Frame = -3 Query: 301 SSFPFHPQIHRNTKTFHSHQTQQAHLTKFTFSPIPVTPNSFWLFFSSARINNHPLCRHFA 122 SS P +P N + HS ++ + + S +P P+ F + N + R + Sbjct: 30 SSSPIYPSSRANESSCHSSNSRFS-TRLYPISSVPENPS----FVGCQQTRN--IVRSYC 82 Query: 121 SEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 S K+ S WT++I YLDESG VI+SGKGIRSVEPGLD Sbjct: 83 SGKSNNGESGGWTEEIEYLDESGSVIYSGKGIRSVEPGLD 122 >ref|XP_008441211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Cucumis melo] Length = 823 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -3 Query: 151 NNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 NN R + S K +G EWT+DI YLDESG VIFSGKG+RSVEPG+D Sbjct: 63 NNRSFTRPYCSGKEIGNGGREWTEDIEYLDESGSVIFSGKGVRSVEPGVD 112 >ref|XP_010265649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Nelumbo nucifera] Length = 845 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/61 (57%), Positives = 41/61 (67%) Frame = -3 Query: 184 SFWLFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGL 5 +F L F CR F+S ++ D S+EWT+DI YLDE G VIFSGKGIRSVEPGL Sbjct: 75 NFDLIFPKFPTGYSSFCRTFSSGESCND-STEWTEDIEYLDEKGSVIFSGKGIRSVEPGL 133 Query: 4 D 2 D Sbjct: 134 D 134 >ref|XP_002316152.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865192|gb|EEF02323.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -3 Query: 175 LFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 L + + + R++ + K GS EWT+DI YLDESG VI+SGKGIRSVEPG+D Sbjct: 18 LVSNGGHVKANSFVRNYCAGKNGEAGSGEWTEDIEYLDESGSVIYSGKGIRSVEPGVD 75 >ref|XP_011014127.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Populus euphratica] Length = 840 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -3 Query: 175 LFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 L + + + R++ + K GS EWT+DI YLDESG VI+SGKGIRSVEPG+D Sbjct: 73 LVSNGGHVKANRFVRNYCAGKNGEAGSGEWTEDIEYLDESGSVIYSGKGIRSVEPGVD 130 >ref|XP_012078463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Jatropha curcas] Length = 841 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/45 (68%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -3 Query: 133 RHFASEKTPT-DGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R++ S K T GSS+WT+DI YLDESG VI+SGKGIRSVEPG+D Sbjct: 86 RNYCSAKNNTGSGSSQWTEDIQYLDESGGVIYSGKGIRSVEPGVD 130 >ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] gi|297333629|gb|EFH64047.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] Length = 832 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/67 (49%), Positives = 41/67 (61%) Frame = -3 Query: 202 IPVTPNSFWLFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIR 23 +P PN F + + R F SEK+ SS WT+++ YLDESG V+ SGKGIR Sbjct: 60 VPRDPN-----FVGLTTQSRSIVRRFCSEKSGGSESSGWTEEVEYLDESGSVLHSGKGIR 114 Query: 22 SVEPGLD 2 SVEPGLD Sbjct: 115 SVEPGLD 121 >ref|XP_002532083.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528243|gb|EEF30297.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 841 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 133 RHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R++ S GS++WT+DI YLDESG VI+SGKGIRSVEPGLD Sbjct: 92 RNYCSGNINEGGSAKWTEDIEYLDESGSVIYSGKGIRSVEPGLD 135 >ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] gi|482569125|gb|EOA33313.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] Length = 836 Score = 63.5 bits (153), Expect = 6e-08 Identities = 39/96 (40%), Positives = 49/96 (51%), Gaps = 27/96 (28%) Frame = -3 Query: 208 SPIPVTPNSFWLFFSSARINNH--------PLC-------------------RHFASEKT 110 SP PV PN +F + R+ ++ P C R F SEK Sbjct: 30 SPSPVNPNLAGSYFFNVRLLSYFAARNGICPDCSVPRDSDFVGLAKQSRSIVRRFCSEKG 89 Query: 109 PTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 + SS WT+++ YLDESG V+ SGKGIRSVEPGLD Sbjct: 90 GSSESSGWTEEVEYLDESGSVLHSGKGIRSVEPGLD 125 >ref|NP_178067.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200795|sp|Q9SAK0.1|PP132_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79490, mitochondrial; AltName: Full=Protein EMBRYO DEFECTIVE 2217; Flags: Precursor gi|4835759|gb|AAD30226.1|AC007202_8 T8K14.9 [Arabidopsis thaliana] gi|332198129|gb|AEE36250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 836 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 139 LCRHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 + R F SEK + SS WT+++ YLDESG V+ SGKGIRSVEPGLD Sbjct: 80 IVRRFCSEKIGSSESSGWTEEVEYLDESGSVLHSGKGIRSVEPGLD 125 >ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] gi|557086318|gb|ESQ27170.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] Length = 836 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 133 RHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R F S+K+ + SS WT+++ YLDESG VI SGKGIRSVEPGLD Sbjct: 82 RRFCSDKSRSSESSGWTEEVEYLDESGSVIHSGKGIRSVEPGLD 125 >ref|XP_010417611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Camelina sativa] Length = 834 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 211 FSP---IPVTPNSFWLFFSSARINNHPLCRHFASEKTPTDGSSEWTDDIVYLDESGDVIF 41 FSP +P P+ F+ + + R F EK + SS WT+++ YLDESG V+ Sbjct: 56 FSPDCSVPRDPD-----FAGLAKPSRSIVRRFCGEKGASSESSGWTEEVEYLDESGSVLH 110 Query: 40 SGKGIRSVEPGLD 2 SGKGIRSVEPGLD Sbjct: 111 SGKGIRSVEPGLD 123 >ref|XP_010025649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Eucalyptus grandis] Length = 835 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/71 (47%), Positives = 42/71 (59%), Gaps = 11/71 (15%) Frame = -3 Query: 181 FWLFFSSARIN-----NHPLCRHFASEKTPTDG------SSEWTDDIVYLDESGDVIFSG 35 FW F + +P C+ F S + G SSEWT++I YLDESG VI+SG Sbjct: 56 FWSPFEGRGVEIPIFAKYPGCQSFRSYCSGMSGGGDGAKSSEWTEEIEYLDESGSVIYSG 115 Query: 34 KGIRSVEPGLD 2 KG+RSVEPGLD Sbjct: 116 KGVRSVEPGLD 126 >ref|XP_012456038.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Gossypium raimondii] gi|763806079|gb|KJB73017.1| hypothetical protein B456_011G209700 [Gossypium raimondii] Length = 824 Score = 60.8 bits (146), Expect = 4e-07 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = -3 Query: 187 NSFWLFFSSARINN----HPLCRHFASEKTP----TDGSSEWTDDIVYLDESGDVIFSGK 32 NSF F SS IN H L ++ P + S EWT+DI YLDESG VI+SGK Sbjct: 44 NSFSFFNSSMGINQISPFHTLYKNPNFIGNPRIVRSYCSGEWTEDIEYLDESGSVIYSGK 103 Query: 31 GIRSVEPGLD 2 GIRSVEPGLD Sbjct: 104 GIRSVEPGLD 113 >ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Solanum lycopersicum] Length = 794 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 133 RHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R++ S K+ S EWT+D+ YLDESG VI+SGKGIRSVEPGLD Sbjct: 43 RYYCSGKS----SDEWTEDVEYLDESGSVIYSGKGIRSVEPGLD 82 >ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum tuberosum] Length = 794 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -3 Query: 133 RHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R++ S K S EWT+D+ YLDESG VI+SGKGIRSVEPGLD Sbjct: 43 RYYCSGKN----SDEWTEDVEYLDESGSVIYSGKGIRSVEPGLD 82 >ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial [Fragaria vesca subsp. vesca] Length = 844 Score = 57.8 bits (138), Expect(2) = 6e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 133 RHFASEKTPTDGSSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 R++ S K S EWT++I YLDESG VI++GKGIRSVEPGLD Sbjct: 94 RNYCSGKN----SDEWTEEIEYLDESGSVIYTGKGIRSVEPGLD 133 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 267 TPKPSILIKPNKPISPNSHFLPFQSPPIHFGCSF 166 +PK S+ I PN S L F + GC F Sbjct: 59 SPKYSVPINPNLVGSSGFSRLNFSENSLSVGCDF 92 >gb|KCW62354.1| hypothetical protein EUGRSUZ_H04993 [Eucalyptus grandis] Length = 706 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 SSEWTDDIVYLDESGDVIFSGKGIRSVEPGLD 2 SSEWT++I YLDESG VI+SGKG+RSVEPGLD Sbjct: 10 SSEWTEEIEYLDESGSVIYSGKGVRSVEPGLD 41