BLASTX nr result
ID: Cinnamomum24_contig00020648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00020648 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35735.3| unnamed protein product [Vitis vinifera] 52 1e-06 >emb|CBI35735.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = +1 Query: 25 SFFFLSVPPQKRLPKEMDQKKGGTSETGYATH------YL*GKSHPSHRKHLQCHDHIGL 186 SF + PP++R +E+ +GG+ E+ + KSHPSHRKHLQCHDHIG Sbjct: 51 SFPIVLFPPRERRTEEVCPARGGSVESFCCLSRELYDLFPYWKSHPSHRKHLQCHDHIGF 110 Query: 187 PFF 195 F Sbjct: 111 ALF 113 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 183 FTLFSLVVQRTVAHP 227 F LFSLVVQRTVA P Sbjct: 110 FALFSLVVQRTVAPP 124