BLASTX nr result
ID: Cinnamomum24_contig00017302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00017302 (199 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010257538.1| PREDICTED: pentatricopeptide repeat-containi... 127 3e-27 ref|XP_003525465.1| PREDICTED: pentatricopeptide repeat-containi... 123 4e-26 gb|KHN48690.1| Pentatricopeptide repeat-containing protein [Glyc... 121 2e-25 ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containi... 120 4e-25 ref|XP_007037367.1| Pentatricopeptide repeat superfamily protein... 120 5e-25 ref|XP_007037366.1| Pentatricopeptide repeat superfamily protein... 120 5e-25 ref|XP_007155307.1| hypothetical protein PHAVU_003G189800g [Phas... 119 1e-24 ref|XP_010091524.1| hypothetical protein L484_015951 [Morus nota... 118 2e-24 ref|XP_011623309.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 gb|KDO55561.1| hypothetical protein CISIN_1g010642mg [Citrus sin... 117 2e-24 ref|XP_006477459.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_006440604.1| hypothetical protein CICLE_v10018999mg [Citr... 117 2e-24 ref|XP_008787150.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_004508732.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_008453206.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 ref|XP_011087244.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_007210264.1| hypothetical protein PRUPE_ppa003212mg [Prun... 115 1e-23 ref|XP_011660092.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_009369289.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_012487560.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 >ref|XP_010257538.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Nelumbo nucifera] Length = 641 Score = 127 bits (319), Expect = 3e-27 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 L+PNI HYGCM+DLLGRAGLLD+AYHLINSM V+ D+TIWRTLLGACRIHGHVALGERVV Sbjct: 402 LIPNIRHYGCMVDLLGRAGLLDEAYHLINSMEVKADSTIWRTLLGACRIHGHVALGERVV 461 Query: 19 GHLIEL 2 GHLIEL Sbjct: 462 GHLIEL 467 >ref|XP_003525465.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Glycine max] Length = 579 Score = 123 bits (309), Expect = 4e-26 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PN+HHYGCM+DLLGRAGLLD+AY LI SMVV+PD+T+WRTLLGACRIHGHV LGERV+ Sbjct: 340 VTPNVHHYGCMVDLLGRAGLLDKAYQLIMSMVVKPDSTMWRTLLGACRIHGHVTLGERVI 399 Query: 19 GHLIEL 2 GHLIEL Sbjct: 400 GHLIEL 405 >gb|KHN48690.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 579 Score = 121 bits (303), Expect = 2e-25 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PN+HHYGCM+DLLGRAGLLD+AY LI SMV +PD+T+WRTLLGACRIHGHV LGERV+ Sbjct: 340 VTPNVHHYGCMVDLLGRAGLLDKAYQLIMSMVEKPDSTMWRTLLGACRIHGHVTLGERVI 399 Query: 19 GHLIEL 2 GHLIEL Sbjct: 400 GHLIEL 405 >ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Vitis vinifera] Length = 643 Score = 120 bits (301), Expect = 4e-25 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -1 Query: 193 PNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVVGH 14 PNIHHYGCM+DLLGRAGLLDQAY LI SMV++PD+T+WRTLLGACRIH H LGERV+GH Sbjct: 406 PNIHHYGCMVDLLGRAGLLDQAYQLIMSMVIKPDSTLWRTLLGACRIHRHATLGERVIGH 465 Query: 13 LIEL 2 LIEL Sbjct: 466 LIEL 469 >ref|XP_007037367.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] gi|508774612|gb|EOY21868.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] Length = 625 Score = 120 bits (300), Expect = 5e-25 Identities = 55/64 (85%), Positives = 59/64 (92%) Frame = -1 Query: 193 PNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVVGH 14 PNIHHYGCM+DLLGRAGLLDQAY +I SM V+PDATIWRTLLGACRIHGHV LGERV+ H Sbjct: 403 PNIHHYGCMVDLLGRAGLLDQAYQVIISMGVKPDATIWRTLLGACRIHGHVTLGERVIEH 462 Query: 13 LIEL 2 LIEL Sbjct: 463 LIEL 466 >ref|XP_007037366.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508774611|gb|EOY21867.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 640 Score = 120 bits (300), Expect = 5e-25 Identities = 55/64 (85%), Positives = 59/64 (92%) Frame = -1 Query: 193 PNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVVGH 14 PNIHHYGCM+DLLGRAGLLDQAY +I SM V+PDATIWRTLLGACRIHGHV LGERV+ H Sbjct: 403 PNIHHYGCMVDLLGRAGLLDQAYQVIISMGVKPDATIWRTLLGACRIHGHVTLGERVIEH 462 Query: 13 LIEL 2 LIEL Sbjct: 463 LIEL 466 >ref|XP_007155307.1| hypothetical protein PHAVU_003G189800g [Phaseolus vulgaris] gi|561028661|gb|ESW27301.1| hypothetical protein PHAVU_003G189800g [Phaseolus vulgaris] Length = 579 Score = 119 bits (297), Expect = 1e-24 Identities = 52/66 (78%), Positives = 60/66 (90%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PN+ HYGCM+DLLGR GLLD+AY LI SMVV+PD+TIWRTLLGACRIHGHV LGE+V+ Sbjct: 340 ITPNVRHYGCMVDLLGRVGLLDKAYQLIMSMVVKPDSTIWRTLLGACRIHGHVTLGEQVI 399 Query: 19 GHLIEL 2 GHLIEL Sbjct: 400 GHLIEL 405 >ref|XP_010091524.1| hypothetical protein L484_015951 [Morus notabilis] gi|587854654|gb|EXB44694.1| hypothetical protein L484_015951 [Morus notabilis] Length = 640 Score = 118 bits (295), Expect = 2e-24 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = -1 Query: 193 PNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVVGH 14 PNIHHYGCM+DLLGRAGLLD+AY LI SM V+PD IWRTLLGACRIHGHV LGERV+GH Sbjct: 403 PNIHHYGCMVDLLGRAGLLDRAYRLIMSMDVKPDPEIWRTLLGACRIHGHVNLGERVIGH 462 Query: 13 LIEL 2 LIEL Sbjct: 463 LIEL 466 >ref|XP_011623309.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Amborella trichopoda] Length = 444 Score = 118 bits (295), Expect = 2e-24 Identities = 50/66 (75%), Positives = 61/66 (92%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 +VPN+HHYGCM+DLLGRAG+L+QAY +I+SM +PDATIWRTLLGACRIHGH LGE+V+ Sbjct: 287 IVPNLHHYGCMVDLLGRAGMLEQAYGIISSMHAKPDATIWRTLLGACRIHGHACLGEKVM 346 Query: 19 GHLIEL 2 GHL+EL Sbjct: 347 GHLVEL 352 >gb|KDO55561.1| hypothetical protein CISIN_1g010642mg [Citrus sinensis] Length = 505 Score = 117 bits (294), Expect = 2e-24 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 ++PNIHHYGC++DLLGRAGLLDQAY LI SM V+PD+TIWRTLLGACRIH HV LGERV+ Sbjct: 266 ILPNIHHYGCVVDLLGRAGLLDQAYQLITSMGVKPDSTIWRTLLGACRIHKHVTLGERVI 325 Query: 19 GHLIEL 2 HLIEL Sbjct: 326 EHLIEL 331 >ref|XP_006477459.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Citrus sinensis] Length = 580 Score = 117 bits (294), Expect = 2e-24 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 ++PNIHHYGC++DLLGRAGLLDQAY LI SM V+PD+TIWRTLLGACRIH HV LGERV+ Sbjct: 341 ILPNIHHYGCVVDLLGRAGLLDQAYQLITSMGVKPDSTIWRTLLGACRIHKHVTLGERVI 400 Query: 19 GHLIEL 2 HLIEL Sbjct: 401 EHLIEL 406 >ref|XP_006440604.1| hypothetical protein CICLE_v10018999mg [Citrus clementina] gi|557542866|gb|ESR53844.1| hypothetical protein CICLE_v10018999mg [Citrus clementina] Length = 745 Score = 117 bits (294), Expect = 2e-24 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 ++PNIHHYGC++DLLGRAGLLDQAY LI SM V+PD+TIWRTLLGACRIH HV LGERV+ Sbjct: 506 ILPNIHHYGCVVDLLGRAGLLDQAYQLITSMGVKPDSTIWRTLLGACRIHKHVTLGERVI 565 Query: 19 GHLIEL 2 HLIEL Sbjct: 566 EHLIEL 571 >ref|XP_008787150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530, partial [Phoenix dactylifera] Length = 602 Score = 117 bits (292), Expect = 4e-24 Identities = 55/67 (82%), Positives = 60/67 (89%), Gaps = 1/67 (1%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYH-LINSMVVEPDATIWRTLLGACRIHGHVALGERV 23 LVPN+ HYGCMIDLLGRAGLLDQAY ++ M V+PDATIWRTLLGACRIHGHV LGERV Sbjct: 362 LVPNVCHYGCMIDLLGRAGLLDQAYEFIVKEMKVQPDATIWRTLLGACRIHGHVDLGERV 421 Query: 22 VGHLIEL 2 +GHLIEL Sbjct: 422 IGHLIEL 428 >ref|XP_004508732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Cicer arietinum] Length = 633 Score = 117 bits (292), Expect = 4e-24 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + P IHHYGCM+DL GRAGLLD+AY LI SM V+PD+T+WRTLLGACRIHG VALGERV+ Sbjct: 394 ITPAIHHYGCMVDLFGRAGLLDKAYQLITSMEVKPDSTVWRTLLGACRIHGDVALGERVI 453 Query: 19 GHLIEL 2 GHLIEL Sbjct: 454 GHLIEL 459 >ref|XP_008453206.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Cucumis melo] Length = 585 Score = 116 bits (290), Expect = 7e-24 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PN+HHYGC++DLLGRAG+LDQAY LI SM V PDAT+WRTLLGACRIHGH LGER+V Sbjct: 346 IAPNVHHYGCIVDLLGRAGMLDQAYELIMSMEVRPDATMWRTLLGACRIHGHANLGERIV 405 Query: 19 GHLIEL 2 HLIEL Sbjct: 406 EHLIEL 411 >ref|XP_011087244.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Sesamum indicum] Length = 582 Score = 115 bits (287), Expect = 1e-23 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PNIHHYGCM+DLLGRAGLLD+AY LINSM ++PDA +WRTLLGACRIH HVALGE+VV Sbjct: 343 VTPNIHHYGCMVDLLGRAGLLDEAYGLINSMRIKPDAAMWRTLLGACRIHRHVALGEQVV 402 Query: 19 GHLIEL 2 HL EL Sbjct: 403 EHLTEL 408 >ref|XP_007210264.1| hypothetical protein PRUPE_ppa003212mg [Prunus persica] gi|462405999|gb|EMJ11463.1| hypothetical protein PRUPE_ppa003212mg [Prunus persica] Length = 592 Score = 115 bits (287), Expect = 1e-23 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 +VPNIHHYGCM+DLLGRAG LDQAY LI SM ++PD+TIWRTLLG CRIHGH AL E V+ Sbjct: 353 VVPNIHHYGCMVDLLGRAGRLDQAYQLILSMDIKPDSTIWRTLLGGCRIHGHDALAESVI 412 Query: 19 GHLIEL 2 GHLIEL Sbjct: 413 GHLIEL 418 >ref|XP_011660092.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Cucumis sativus] gi|700208575|gb|KGN63671.1| hypothetical protein Csa_1G009750 [Cucumis sativus] Length = 602 Score = 115 bits (287), Expect = 1e-23 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 + PN+HHYGC++DLLGRAG+LDQAY LI SM V PDAT+WRTLLGACRIHGH LGER+V Sbjct: 363 IAPNVHHYGCIVDLLGRAGMLDQAYELIMSMEVRPDATMWRTLLGACRIHGHGNLGERIV 422 Query: 19 GHLIEL 2 HLIEL Sbjct: 423 EHLIEL 428 >ref|XP_009369289.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Pyrus x bretschneideri] Length = 599 Score = 114 bits (286), Expect = 2e-23 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 +VPN+HHYGCM+DLLGRAG LDQAY LI SM ++PD TIWRTLLGACRIHG +L ERVV Sbjct: 360 VVPNVHHYGCMVDLLGRAGQLDQAYQLITSMDIKPDPTIWRTLLGACRIHGSDSLAERVV 419 Query: 19 GHLIEL 2 GHLIEL Sbjct: 420 GHLIEL 425 >ref|XP_012487560.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Gossypium raimondii] gi|763771470|gb|KJB38685.1| hypothetical protein B456_006G267000 [Gossypium raimondii] Length = 638 Score = 114 bits (285), Expect = 3e-23 Identities = 50/66 (75%), Positives = 59/66 (89%) Frame = -1 Query: 199 LVPNIHHYGCMIDLLGRAGLLDQAYHLINSMVVEPDATIWRTLLGACRIHGHVALGERVV 20 ++PN+HHYGC++DLLGRAGLL+QAY +I SM V+PDA IWRTLLGACRIHGH LGERV+ Sbjct: 399 IMPNVHHYGCVVDLLGRAGLLEQAYRVIISMKVKPDAAIWRTLLGACRIHGHFTLGERVI 458 Query: 19 GHLIEL 2 HLIEL Sbjct: 459 EHLIEL 464