BLASTX nr result
ID: Cinnamomum24_contig00017038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00017038 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008813715.1| PREDICTED: two-component response regulator ... 57 4e-06 >ref|XP_008813715.1| PREDICTED: two-component response regulator ARR1-like [Phoenix dactylifera] Length = 739 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/84 (36%), Positives = 53/84 (63%) Frame = -1 Query: 280 NSSSMMQMPRQGHQLPDSQSQSKMQADISEHMQSRGMSLDENAGRHNLELPSSVGQQLIS 101 ++SS+MQM +G Q SQ ++++ A + + Q+RG+ L+ AG H+ LP+++G Q++S Sbjct: 433 SNSSVMQMTHRGQQFSLSQQRNQIHASMPQLPQTRGLILNGIAGEHDSRLPTTIG-QILS 491 Query: 100 NENLGRVSGRNAIVMNGRGTSSGG 29 NE +SGR+ MN + GG Sbjct: 492 NEVSSHISGRSGSNMNVDTSLPGG 515