BLASTX nr result
ID: Cinnamomum24_contig00016691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00016691 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842731.1| PREDICTED: phospholipid-transporting ATPase ... 81 3e-13 ref|XP_009778604.1| PREDICTED: phospholipid-transporting ATPase ... 80 5e-13 ref|XP_009778603.1| PREDICTED: phospholipid-transporting ATPase ... 80 5e-13 ref|XP_009614356.1| PREDICTED: phospholipid-transporting ATPase ... 80 5e-13 ref|XP_009614354.1| PREDICTED: phospholipid-transporting ATPase ... 80 5e-13 ref|XP_010917574.1| PREDICTED: phospholipid-transporting ATPase ... 79 1e-12 ref|XP_010098237.1| Phospholipid-transporting ATPase 3 [Morus no... 79 2e-12 ref|XP_010255676.1| PREDICTED: phospholipid-transporting ATPase ... 79 2e-12 ref|XP_010272161.1| PREDICTED: phospholipid-transporting ATPase ... 78 2e-12 ref|XP_010272160.1| PREDICTED: phospholipid-transporting ATPase ... 78 2e-12 ref|XP_002520179.1| Phospholipid-transporting ATPase, putative [... 78 2e-12 ref|XP_010553648.1| PREDICTED: phospholipid-transporting ATPase ... 78 3e-12 ref|XP_010553647.1| PREDICTED: phospholipid-transporting ATPase ... 78 3e-12 ref|XP_006357228.1| PREDICTED: phospholipid-transporting ATPase ... 78 3e-12 ref|XP_007044429.1| Aminophospholipid ATPase isoform 3 [Theobrom... 78 3e-12 ref|XP_007044428.1| Aminophospholipid ATPase isoform 2 [Theobrom... 78 3e-12 ref|XP_007044427.1| Aminophospholipid ATPase isoform 1 [Theobrom... 78 3e-12 ref|XP_004238741.1| PREDICTED: phospholipid-transporting ATPase ... 78 3e-12 ref|XP_008803426.1| PREDICTED: phospholipid-transporting ATPase ... 77 3e-12 emb|CDP00250.1| unnamed protein product [Coffea canephora] 77 3e-12 >ref|XP_006842731.1| PREDICTED: phospholipid-transporting ATPase 3 [Amborella trichopoda] gi|548844845|gb|ERN04406.1| hypothetical protein AMTR_s00133p00030750 [Amborella trichopoda] Length = 1226 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRT 150 RETSKHTGFAFDSP YESFFA GV P +AWDVARRASM++RQPRT Sbjct: 1176 RETSKHTGFAFDSPGYESFFASLHGVNVPQRAWDVARRASMRSRQPRT 1223 >ref|XP_009778604.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X2 [Nicotiana sylvestris] Length = 1131 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTR 162 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASMKTR Sbjct: 1082 QKSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMKTR 1124 >ref|XP_009778603.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X1 [Nicotiana sylvestris] Length = 1219 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTR 162 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASMKTR Sbjct: 1170 QKSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMKTR 1212 >ref|XP_009614356.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X3 [Nicotiana tomentosiformis] gi|697120775|ref|XP_009614357.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X3 [Nicotiana tomentosiformis] Length = 1131 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTR 162 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASMKTR Sbjct: 1082 QKSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMKTR 1124 >ref|XP_009614354.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X1 [Nicotiana tomentosiformis] Length = 1219 Score = 80.1 bits (196), Expect = 5e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTR 162 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASMKTR Sbjct: 1170 QKSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMKTR 1212 >ref|XP_010917574.1| PREDICTED: phospholipid-transporting ATPase 3 [Elaeis guineensis] Length = 1004 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 2/50 (4%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKT--RQPRT 150 RE SKHTGFAFDSP YESFFA Q GV AP KAWDVARRASM++ R+PRT Sbjct: 955 REKSKHTGFAFDSPGYESFFASQQGVFAPQKAWDVARRASMRSQQRKPRT 1004 >ref|XP_010098237.1| Phospholipid-transporting ATPase 3 [Morus notabilis] gi|587885878|gb|EXB74722.1| Phospholipid-transporting ATPase 3 [Morus notabilis] Length = 1304 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTR 162 RE SKHTGFAFDSP YESFFA Q GV AP KAWDVARRASMK+R Sbjct: 1254 RELSKHTGFAFDSPGYESFFAAQLGVFAPQKAWDVARRASMKSR 1297 >ref|XP_010255676.1| PREDICTED: phospholipid-transporting ATPase 3-like [Nelumbo nucifera] Length = 1231 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 +E SKHTGFAFDSP YESFFA Q GV AP KAWDVARRASM++ QPRT K Sbjct: 1181 KEKSKHTGFAFDSPGYESFFASQQGVFAPQKAWDVARRASMRS-QPRTEK 1229 >ref|XP_010272161.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X2 [Nelumbo nucifera] Length = 1175 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMK--TRQPRT 150 RETSKHTGFAFDSP YESFFA Q GV AP K WDVARRASM+ +R PRT Sbjct: 1125 RETSKHTGFAFDSPGYESFFASQQGVYAPQKPWDVARRASMRSQSRTPRT 1174 >ref|XP_010272160.1| PREDICTED: phospholipid-transporting ATPase 3-like isoform X1 [Nelumbo nucifera] Length = 1230 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMK--TRQPRT 150 RETSKHTGFAFDSP YESFFA Q GV AP K WDVARRASM+ +R PRT Sbjct: 1180 RETSKHTGFAFDSPGYESFFASQQGVYAPQKPWDVARRASMRSQSRTPRT 1229 >ref|XP_002520179.1| Phospholipid-transporting ATPase, putative [Ricinus communis] gi|223540671|gb|EEF42234.1| Phospholipid-transporting ATPase, putative [Ricinus communis] Length = 1219 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASM++ QP+T K Sbjct: 1169 REISKHTGFAFDSPGYESFFAAQLGIYAPQKAWDVARRASMRS-QPKTPK 1217 >ref|XP_010553648.1| PREDICTED: phospholipid-transporting ATPase 3 isoform X2 [Tarenaya hassleriana] Length = 1125 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASM++R P+T K Sbjct: 1075 REISKHTGFAFDSPGYESFFASQLGIYAPQKAWDVARRASMRSR-PKTPK 1123 >ref|XP_010553647.1| PREDICTED: phospholipid-transporting ATPase 3 isoform X1 [Tarenaya hassleriana] Length = 1217 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASM++R P+T K Sbjct: 1167 REISKHTGFAFDSPGYESFFASQLGIYAPQKAWDVARRASMRSR-PKTPK 1215 >ref|XP_006357228.1| PREDICTED: phospholipid-transporting ATPase 3-like [Solanum tuberosum] Length = 1221 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASM +P+ K Sbjct: 1171 QKSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMMKSRPKAPK 1219 >ref|XP_007044429.1| Aminophospholipid ATPase isoform 3 [Theobroma cacao] gi|508708364|gb|EOY00261.1| Aminophospholipid ATPase isoform 3 [Theobroma cacao] Length = 943 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASMK++ P+T K Sbjct: 893 REISKHTGFAFDSPGYESFFASQLGIYAPQKAWDVARRASMKSK-PKTNK 941 >ref|XP_007044428.1| Aminophospholipid ATPase isoform 2 [Theobroma cacao] gi|508708363|gb|EOY00260.1| Aminophospholipid ATPase isoform 2 [Theobroma cacao] Length = 1226 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASMK++ P+T K Sbjct: 1176 REISKHTGFAFDSPGYESFFASQLGIYAPQKAWDVARRASMKSK-PKTNK 1224 >ref|XP_007044427.1| Aminophospholipid ATPase isoform 1 [Theobroma cacao] gi|508708362|gb|EOY00259.1| Aminophospholipid ATPase isoform 1 [Theobroma cacao] Length = 1225 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 RE SKHTGFAFDSP YESFFA Q G+ AP KAWDVARRASMK++ P+T K Sbjct: 1175 REISKHTGFAFDSPGYESFFASQLGIYAPQKAWDVARRASMKSK-PKTNK 1223 >ref|XP_004238741.1| PREDICTED: phospholipid-transporting ATPase 3-like [Solanum lycopersicum] Length = 1221 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRTLK 144 + SKHTGFAFDSP YESFFA QAGVLAP KAWDVARRASM +P+ K Sbjct: 1171 QRSKHTGFAFDSPGYESFFASQAGVLAPQKAWDVARRASMMKSRPKVPK 1219 >ref|XP_008803426.1| PREDICTED: phospholipid-transporting ATPase 3 [Phoenix dactylifera] Length = 1230 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -1 Query: 293 RETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQ 159 RE SKHTGFAFDSP YESFFA Q GV AP KAWDVARRASM+++Q Sbjct: 1181 REKSKHTGFAFDSPGYESFFASQQGVFAPQKAWDVARRASMRSQQ 1225 >emb|CDP00250.1| unnamed protein product [Coffea canephora] Length = 1224 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -1 Query: 290 ETSKHTGFAFDSPSYESFFALQAGVLAPLKAWDVARRASMKTRQPRT 150 E SKHTGFAFDSP YESFFA QAGV P KAWDVARRASMK+R P+T Sbjct: 1175 EKSKHTGFAFDSPGYESFFASQAGVFVPQKAWDVARRASMKSR-PKT 1220