BLASTX nr result
ID: Cinnamomum24_contig00016654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00016654 (393 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588297.1| Cytochrome c biogenesis FN [Medicago truncat... 60 2e-16 >ref|XP_003588297.1| Cytochrome c biogenesis FN [Medicago truncatula] Length = 856 Score = 60.5 bits (145), Expect(3) = 2e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 255 HSCPEEKQMLMTPR*TTGSATDVDEQHPSAIE 160 HSCPEEKQMLMTPR TGSATDVDEQ PSA+E Sbjct: 89 HSCPEEKQMLMTPRLMTGSATDVDEQDPSALE 120 Score = 37.0 bits (84), Expect(3) = 2e-16 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 305 TLMDWTTGTMSSLAGYNILVPKK 237 TLMDWTTGT SSL GYN P++ Sbjct: 72 TLMDWTTGTRSSLPGYNHSCPEE 94 Score = 34.3 bits (77), Expect(3) = 2e-16 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 367 KYPSQGFKRMPQGSLRNGW 311 ++ S FKRMPQGSLRNGW Sbjct: 53 RHLSTRFKRMPQGSLRNGW 71