BLASTX nr result
ID: Cinnamomum24_contig00013095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00013095 (308 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278103.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010278101.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_006585147.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 gb|AET04090.2| pentatricopeptide (PPR) repeat protein [Medicago ... 57 6e-06 ref|XP_003629614.1| Pentatricopeptide repeat-containing protein ... 57 6e-06 ref|XP_006573154.1| PREDICTED: putative pentatricopeptide repeat... 56 8e-06 >ref|XP_010278103.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like isoform X3 [Nelumbo nucifera] Length = 691 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/75 (41%), Positives = 52/75 (69%) Frame = +3 Query: 84 SYSNIAANLNPDDEFSRTQFLDSLKFQCNNLENMKLDDALNMFDQMLLMRPFPSIDPFNR 263 S SNI+++L PD S TQF + +K +C + ++ LDDA+ F++M+ MRP PS+ FN Sbjct: 42 SISNISSSLAPDIS-SHTQFENLVKIKCKS-GSISLDDAMGFFNRMIQMRPTPSVFAFNH 99 Query: 264 LLGAVSRMRHYSTVV 308 +L A+++M+ Y +V+ Sbjct: 100 ILAAIAKMKQYPSVL 114 >ref|XP_010278101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like isoform X1 [Nelumbo nucifera] Length = 751 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/75 (41%), Positives = 52/75 (69%) Frame = +3 Query: 84 SYSNIAANLNPDDEFSRTQFLDSLKFQCNNLENMKLDDALNMFDQMLLMRPFPSIDPFNR 263 S SNI+++L PD S TQF + +K +C + ++ LDDA+ F++M+ MRP PS+ FN Sbjct: 42 SISNISSSLAPDIS-SHTQFENLVKIKCKS-GSISLDDAMGFFNRMIQMRPTPSVFAFNH 99 Query: 264 LLGAVSRMRHYSTVV 308 +L A+++M+ Y +V+ Sbjct: 100 ILAAIAKMKQYPSVL 114 >ref|XP_006585147.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Glycine max] gi|571470888|ref|XP_003532739.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Glycine max] Length = 611 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 1/95 (1%) Frame = +3 Query: 27 GTNPSQSSLFSYPFAIIRISYSNIAANLNPDDEFSR-TQFLDSLKFQCNNLENMKLDDAL 203 GT S+ S F++ + + + N D S TQFL S++ C + + +D+AL Sbjct: 19 GTFSRSLSIRSPSFSLFFSKHCHCSTNTYDTDSHSNGTQFLISMRNLCKSGKVKNIDEAL 78 Query: 204 NMFDQMLLMRPFPSIDPFNRLLGAVSRMRHYSTVV 308 ++F M M+P PS+ F LLG + R++HY+T + Sbjct: 79 DLFQGMASMKPLPSVKDFTLLLGVIVRLKHYTTAI 113 >gb|AET04090.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 608 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = +3 Query: 84 SYSNIAANLNPD--DEFSRTQFLDSLKFQCNNLENMKLDDALNMFDQMLLMRPFPSIDPF 257 S+ + N+N + ++TQFL+ ++ QC + + +D+ALN F M M P PS+ F Sbjct: 35 SHCTKSTNINHEIQSHSNKTQFLNFMRNQCKSGKLKSIDEALNFFHTMAKMNPLPSVIDF 94 Query: 258 NRLLGAVSRMRHYSTVV 308 LLG + +M+HY+T + Sbjct: 95 TLLLGFIVKMKHYTTAI 111 >ref|XP_003629614.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 592 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = +3 Query: 84 SYSNIAANLNPD--DEFSRTQFLDSLKFQCNNLENMKLDDALNMFDQMLLMRPFPSIDPF 257 S+ + N+N + ++TQFL+ ++ QC + + +D+ALN F M M P PS+ F Sbjct: 19 SHCTKSTNINHEIQSHSNKTQFLNFMRNQCKSGKLKSIDEALNFFHTMAKMNPLPSVIDF 78 Query: 258 NRLLGAVSRMRHYSTVV 308 LLG + +M+HY+T + Sbjct: 79 TLLLGFIVKMKHYTTAI 95 >ref|XP_006573154.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like isoform X2 [Glycine max] gi|571434288|ref|XP_003517841.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like isoform X1 [Glycine max] Length = 604 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/89 (37%), Positives = 53/89 (59%), Gaps = 1/89 (1%) Frame = +3 Query: 45 SSLFSYPFAIIRISYSNIAANLNPDDEFSRTQFLDSLKFQCNNLENMK-LDDALNMFDQM 221 SS S PF ++ S+S+ + D + SR QFLDS++ N K +D AL+ + +M Sbjct: 27 SSSNSKPF-LLHPSHSSSTFSFVSDSDTSRAQFLDSMR-------NAKSVDVALDFYHKM 78 Query: 222 LLMRPFPSIDPFNRLLGAVSRMRHYSTVV 308 + M+PFP + FN L V++M+HY+T + Sbjct: 79 VTMKPFPCVKDFNLLFSIVAKMKHYTTAI 107