BLASTX nr result
ID: Cinnamomum24_contig00012995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00012995 (472 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010439494.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_010434199.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_010434198.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_010434197.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 gb|AID21585.1| AT4G21300p [Arabidopsis halleri] 63 7e-08 ref|XP_006286154.1| hypothetical protein CARUB_v10007713mg [Caps... 63 7e-08 ref|XP_010449091.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 gb|AID21657.1| At4g21300p-like protein [Arabidopsis lyrata] 62 1e-07 ref|XP_006413798.1| hypothetical protein EUTSA_v10024394mg [Eutr... 62 1e-07 ref|XP_002869895.1| pentatricopeptide repeat-containing protein ... 62 1e-07 ref|XP_007014654.1| Pentatricopeptide repeat (PPR) superfamily p... 62 2e-07 ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phas... 61 3e-07 ref|XP_010925270.1| PREDICTED: putative pentatricopeptide repeat... 61 3e-07 gb|AID21624.1| At4g21300p-like protein [Arabidopsis lyrata] 61 3e-07 ref|XP_010665377.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 emb|CBI39303.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002280412.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_002533783.1| pentatricopeptide repeat-containing protein,... 60 4e-07 ref|NP_001190038.1| putative pentatricopeptide repeat-containing... 60 4e-07 ref|XP_006468372.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 >ref|XP_010439494.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Camelina sativa] Length = 825 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/52 (46%), Positives = 43/52 (82%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK++G++K G+S IE+ ++ H+FV+GD +HP++ IYS+L++++EE+R Sbjct: 751 RSLMKEKGVQKIPGYSWIEINKITHLFVSGDVNHPKSSHIYSLLNLLLEELR 802 >ref|XP_010434199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X3 [Camelina sativa] Length = 675 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/52 (46%), Positives = 43/52 (82%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK++G++K G+S IE+ ++ H+FV+GD +HP++ IYS+L++++EE+R Sbjct: 601 RSLMKEKGVQKIPGYSWIEINKITHLFVSGDVNHPKSSHIYSLLNLLLEELR 652 >ref|XP_010434198.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X2 [Camelina sativa] Length = 704 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/52 (46%), Positives = 43/52 (82%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK++G++K G+S IE+ ++ H+FV+GD +HP++ IYS+L++++EE+R Sbjct: 630 RSLMKEKGVQKIPGYSWIEINKITHLFVSGDVNHPKSSHIYSLLNLLLEELR 681 >ref|XP_010434197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 isoform X1 [Camelina sativa] Length = 842 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/52 (46%), Positives = 43/52 (82%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK++G++K G+S IE+ ++ H+FV+GD +HP++ IYS+L++++EE+R Sbjct: 768 RSLMKEKGVQKIPGYSWIEINKITHLFVSGDVNHPKSSHIYSLLNLLLEELR 819 >gb|AID21585.1| AT4G21300p [Arabidopsis halleri] Length = 853 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/52 (48%), Positives = 42/52 (80%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK+R ++K G+S IE+ ++ H+FV+GD +HPE+ IYS+L++++EE+R Sbjct: 765 RSLMKEREVQKIPGYSWIEINKITHLFVSGDVNHPESSHIYSLLNLLLEELR 816 >ref|XP_006286154.1| hypothetical protein CARUB_v10007713mg [Capsella rubella] gi|482554859|gb|EOA19052.1| hypothetical protein CARUB_v10007713mg [Capsella rubella] Length = 854 Score = 63.2 bits (152), Expect = 7e-08 Identities = 24/52 (46%), Positives = 42/52 (80%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK+RG++K G+S +E+ +V H+FV+GD +HP + IYS++++++EE+R Sbjct: 768 RSLMKERGVQKIPGYSWVEINKVTHLFVSGDVNHPNSSHIYSLVNLLLEELR 819 >ref|XP_010449091.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Camelina sativa] gi|727553553|ref|XP_010449092.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Camelina sativa] Length = 825 Score = 62.8 bits (151), Expect = 9e-08 Identities = 24/52 (46%), Positives = 43/52 (82%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK++G++K G+S IE+ +V H+FV+GD +HP++ IYS+L++++EE++ Sbjct: 751 RSLMKEKGVQKIPGYSWIEINKVTHLFVSGDVTHPKSSHIYSLLNLLLEELK 802 >gb|AID21657.1| At4g21300p-like protein [Arabidopsis lyrata] Length = 853 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK+R ++K G+S IE+ ++ H+FV+GD +HPE+ IYS+L+ ++EE+R Sbjct: 765 RSLMKEREVQKIPGYSWIEINKITHLFVSGDVNHPESSHIYSLLNSLLEELR 816 >ref|XP_006413798.1| hypothetical protein EUTSA_v10024394mg [Eutrema salsugineum] gi|557114968|gb|ESQ55251.1| hypothetical protein EUTSA_v10024394mg [Eutrema salsugineum] Length = 842 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/52 (48%), Positives = 40/52 (76%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK+RG+EK G S I++ ++ H FV+GD++HPE IYS+L +++EE++ Sbjct: 768 RSLMKERGVEKVPGSSWIDINKLTHCFVSGDENHPEYSHIYSLLCLLLEELK 819 >ref|XP_002869895.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315731|gb|EFH46154.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 853 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK+R ++K G+S IE+ ++ H+FV+GD +HPE+ IYS+L+ ++EE+R Sbjct: 765 RSLMKEREVQKIPGYSWIEINKITHLFVSGDVNHPESSHIYSLLNSLLEELR 816 >ref|XP_007014654.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590582550|ref|XP_007014655.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508785017|gb|EOY32273.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508785018|gb|EOY32274.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 540 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/63 (42%), Positives = 42/63 (66%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMRCFTHQLAD 292 R++M+D+G+ K G S I+V AH F+AGD SHP+ D I+ IL + E+++ H L++ Sbjct: 472 RKMMRDQGVPKMPGRSFIQVSNRAHEFIAGDVSHPQYDRIHGILFNLNEQLKIVHHLLSE 531 Query: 291 MDE 283 DE Sbjct: 532 FDE 534 >ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] gi|561023297|gb|ESW22027.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] Length = 514 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 RR+MK+RGI+K G S IE++ H FVAGDKSH END +Y+ L ++ E++ Sbjct: 446 RRIMKERGIQKIPGFSSIEIDSSIHKFVAGDKSHEENDHVYAALELLSFELQ 497 >ref|XP_010925270.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Elaeis guineensis] Length = 763 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMRC 313 R+++ DRGI K G S IEV H FVAGD+SHP +DEIYS L M +E++C Sbjct: 617 RQMIMDRGIRKTPGCSLIEVNGEVHEFVAGDRSHPGSDEIYSKLEEMSKELKC 669 >gb|AID21624.1| At4g21300p-like protein [Arabidopsis lyrata] Length = 853 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/52 (46%), Positives = 41/52 (78%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LM++R ++K G+S IE+ ++ H+FV+GD +HPE+ IYS+L+ ++EE+R Sbjct: 765 RSLMREREVQKIPGYSWIEINKITHLFVSGDVNHPESSHIYSLLNSLLEELR 816 >ref|XP_010665377.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 isoform X1 [Vitis vinifera] gi|731431286|ref|XP_010665378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 isoform X1 [Vitis vinifera] gi|731431288|ref|XP_010665379.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 isoform X1 [Vitis vinifera] Length = 804 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMKDRG++K+ G S IEV V H FVAGD+SHP + IY L M+EE++ Sbjct: 656 RNLMKDRGVKKEPGLSWIEVGNVVHSFVAGDRSHPNSQVIYVQLEEMLEEIK 707 >emb|CBI39303.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMKDRG++K+ G S IEV V H FVAGD+SHP + IY L M+EE++ Sbjct: 577 RNLMKDRGVKKEPGLSWIEVGNVVHSFVAGDRSHPNSQVIYVQLEEMLEEIK 628 >ref|XP_002280412.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 isoform X2 [Vitis vinifera] Length = 802 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMKDRG++K+ G S IEV V H FVAGD+SHP + IY L M+EE++ Sbjct: 656 RNLMKDRGVKKEPGLSWIEVGNVVHSFVAGDRSHPNSQVIYVQLEEMLEEIK 707 >ref|XP_002533783.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526284|gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 672 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R LMK RG++K G+S IEV + H+FVA D SHPE+ +IYS+L+ ++ E+R Sbjct: 602 RSLMKKRGVQKVPGYSWIEVNKTTHMFVAADGSHPESAQIYSVLNNLLLELR 653 >ref|NP_001190038.1| putative pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546754|sp|P0C899.1|PP271_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g49142 gi|332644983|gb|AEE78504.1| putative pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 686 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/52 (44%), Positives = 39/52 (75%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEMR 316 R +MK +G++K G S +EV R+ H F+ GD+SHP++DEIY L +++++M+ Sbjct: 535 RNIMKSKGLKKNPGASNVEVNRIIHTFLVGDRSHPQSDEIYRELDVLVKKMK 586 >ref|XP_006468372.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Citrus sinensis] Length = 847 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/51 (49%), Positives = 41/51 (80%) Frame = -2 Query: 471 RRLMKDRGIEKQAGHSRIEVERVAHVFVAGDKSHPENDEIYSILSMMMEEM 319 RRLMK+RG++K G+S IE+ + H+FVA D+SH E+ +IYS+L++++ E+ Sbjct: 777 RRLMKERGVQKIPGYSWIELNNITHLFVAADESHSESAQIYSLLNILLPEL 827