BLASTX nr result
ID: Cinnamomum24_contig00012854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00012854 (403 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA13034.1| TPA: histone cluster 1, H2bo-like [Bos taurus] 71 2e-10 gb|AAA50377.1| spermatid-specific, partial [Mus musculus domesti... 70 4e-10 ref|NP_001099584.1| histone cluster 1, H2bo [Rattus norvegicus] ... 70 4e-10 ref|NP_835509.2| histone H2B type 1-P isoform 1 [Mus musculus] g... 70 4e-10 ref|XP_006988930.1| PREDICTED: histone H2B type 1-M-like isoform... 70 5e-10 ref|NP_001141398.1| histone H2B.4 [Zea mays] gi|1346251|sp|P4912... 69 1e-09 ref|XP_010905724.1| PREDICTED: histone H2B.1 [Elaeis guineensis] 69 1e-09 ref|XP_010937687.1| PREDICTED: histone H2B-like [Elaeis guineens... 69 1e-09 ref|XP_010937686.1| PREDICTED: histone H2B [Elaeis guineensis] 69 1e-09 ref|XP_010937676.1| PREDICTED: histone H2B.11-like [Elaeis guine... 69 1e-09 ref|XP_010922405.1| PREDICTED: histone H2B-like [Elaeis guineensis] 69 1e-09 ref|XP_010922381.1| PREDICTED: histone H2B.11 [Elaeis guineensis] 69 1e-09 ref|XP_010920677.1| PREDICTED: histone H2B-like [Elaeis guineensis] 69 1e-09 ref|XP_010920668.1| PREDICTED: histone H2B.11-like [Elaeis guine... 69 1e-09 ref|XP_010230326.1| PREDICTED: histone H2B.3-like [Brachypodium ... 69 1e-09 ref|XP_010260098.1| PREDICTED: histone H2B-like [Nelumbo nucifera] 69 1e-09 ref|XP_009380667.1| PREDICTED: histone H2B.11 [Musa acuminata su... 69 1e-09 ref|XP_009416254.1| PREDICTED: histone H2B-like [Musa acuminata ... 69 1e-09 ref|XP_009414311.1| PREDICTED: histone H2B-like [Musa acuminata ... 69 1e-09 ref|XP_009409532.1| PREDICTED: histone H2B.11 [Musa acuminata su... 69 1e-09 >tpg|DAA13034.1| TPA: histone cluster 1, H2bo-like [Bos taurus] Length = 89 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*IVWFRSMG 271 TSRE QT+VRL+LPGELAKHAVSEGTKAVTK+TSS ++W R G Sbjct: 35 TSREFQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKVLWSRQSG 78 >gb|AAA50377.1| spermatid-specific, partial [Mus musculus domesticus] Length = 134 Score = 70.5 bits (171), Expect = 4e-10 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*IVWFRSMGH*GFYHL 250 TSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS I+W + FY+L Sbjct: 87 TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKILWNK------FYYL 131 >ref|NP_001099584.1| histone cluster 1, H2bo [Rattus norvegicus] gi|149029301|gb|EDL84568.1| rCG23099 [Rattus norvegicus] Length = 138 Score = 70.5 bits (171), Expect = 4e-10 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*IVWFRSMGH*GFYHL 250 TSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS I+W + FY+L Sbjct: 91 TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKILWNK------FYYL 135 >ref|NP_835509.2| histone H2B type 1-P isoform 1 [Mus musculus] gi|38512027|gb|AAH61044.1| Hist1h2bp protein [Mus musculus] gi|148700680|gb|EDL32627.1| mCG50292 [Mus musculus] Length = 138 Score = 70.5 bits (171), Expect = 4e-10 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*IVWFRSMGH*GFYHL 250 TSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS I+W + FY+L Sbjct: 91 TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKILWNK------FYYL 135 >ref|XP_006988930.1| PREDICTED: histone H2B type 1-M-like isoform X1 [Peromyscus maniculatus bairdii] Length = 144 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*IVW 286 TSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS I+W Sbjct: 91 TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNILW 129 >ref|NP_001141398.1| histone H2B.4 [Zea mays] gi|1346251|sp|P49120.3|H2B4_MAIZE RecName: Full=Histone H2B.4 gi|577819|emb|CAA49585.1| H2B histone [Zea mays] gi|194704356|gb|ACF86262.1| unknown [Zea mays] gi|414879790|tpg|DAA56921.1| TPA: histone H2B.4 [Zea mays] Length = 137 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 137 >ref|XP_010905724.1| PREDICTED: histone H2B.1 [Elaeis guineensis] Length = 141 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 141 >ref|XP_010937687.1| PREDICTED: histone H2B-like [Elaeis guineensis] gi|743842018|ref|XP_010937688.1| PREDICTED: histone H2B-like [Elaeis guineensis] gi|743842022|ref|XP_010937689.1| PREDICTED: histone H2B-like [Elaeis guineensis] Length = 149 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 >ref|XP_010937686.1| PREDICTED: histone H2B [Elaeis guineensis] Length = 149 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 115 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149 >ref|XP_010937676.1| PREDICTED: histone H2B.11-like [Elaeis guineensis] Length = 154 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 120 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154 >ref|XP_010922405.1| PREDICTED: histone H2B-like [Elaeis guineensis] Length = 186 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 152 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 186 >ref|XP_010922381.1| PREDICTED: histone H2B.11 [Elaeis guineensis] Length = 153 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 119 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 153 >ref|XP_010920677.1| PREDICTED: histone H2B-like [Elaeis guineensis] Length = 154 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 120 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154 >ref|XP_010920668.1| PREDICTED: histone H2B.11-like [Elaeis guineensis] Length = 154 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 120 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154 >ref|XP_010230326.1| PREDICTED: histone H2B.3-like [Brachypodium distachyon] Length = 155 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 121 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 155 >ref|XP_010260098.1| PREDICTED: histone H2B-like [Nelumbo nucifera] Length = 158 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 124 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 158 >ref|XP_009380667.1| PREDICTED: histone H2B.11 [Musa acuminata subsp. malaccensis] Length = 152 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 118 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152 >ref|XP_009416254.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis] Length = 158 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 124 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 158 >ref|XP_009414311.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 117 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 151 >ref|XP_009409532.1| PREDICTED: histone H2B.11 [Musa acuminata subsp. malaccensis] Length = 152 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 402 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 298 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 118 TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152