BLASTX nr result
ID: Cinnamomum24_contig00012652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00012652 (315 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008649730.1| PREDICTED: uncharacterized protein LOC103630... 58 2e-06 gb|AFW78327.1| hypothetical protein ZEAMMB73_424215 [Zea mays] 58 2e-06 >ref|XP_008649730.1| PREDICTED: uncharacterized protein LOC103630455 [Zea mays] Length = 514 Score = 58.2 bits (139), Expect = 2e-06 Identities = 39/112 (34%), Positives = 58/112 (51%), Gaps = 11/112 (9%) Frame = -2 Query: 305 EECKDLLVDPNLARYFSS-NNQPLQIKELAPWKPTIISC---------GECNYIGDTVIK 156 EEC+ LL+DP L +F ++ LQ+ ELAP + TI +C C+ D K Sbjct: 334 EECQSLLLDPKLPPFFGCCASKILQVDELAPRELTIKACFVCFKSLGFSGCSRCHDIPYK 393 Query: 155 IADYSFES-CRHWESRKQLCTINPKFPNVVRELGGTFIAGPALFMVTDELNV 3 + +E+ C + +LC NPK PN E G +++G F+VTD+L V Sbjct: 394 NSLRRYEAFCANTVKSIKLCEANPKEPNGGSEKGEVYVSGKTNFLVTDDLRV 445 >gb|AFW78327.1| hypothetical protein ZEAMMB73_424215 [Zea mays] Length = 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 39/112 (34%), Positives = 58/112 (51%), Gaps = 11/112 (9%) Frame = -2 Query: 305 EECKDLLVDPNLARYFSS-NNQPLQIKELAPWKPTIISC---------GECNYIGDTVIK 156 EEC+ LL+DP L +F ++ LQ+ ELAP + TI +C C+ D K Sbjct: 435 EECQSLLLDPKLPPFFGCCASKILQVDELAPRELTIKACFVCFKSLGFSGCSRCHDIPYK 494 Query: 155 IADYSFES-CRHWESRKQLCTINPKFPNVVRELGGTFIAGPALFMVTDELNV 3 + +E+ C + +LC NPK PN E G +++G F+VTD+L V Sbjct: 495 NSLRRYEAFCANTVKSIKLCEANPKEPNGGSEKGEVYVSGKTNFLVTDDLRV 546