BLASTX nr result
ID: Cinnamomum24_contig00011678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00011678 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275977.1| PREDICTED: plastid division protein CDP1, ch... 72 1e-10 ref|XP_011624786.1| PREDICTED: plastid division protein CDP1, ch... 72 2e-10 gb|ERN09423.1| hypothetical protein AMTR_s00029p00059460 [Ambore... 72 2e-10 emb|CDO98565.1| unnamed protein product [Coffea canephora] 70 4e-10 ref|XP_012434838.1| PREDICTED: plastid division protein CDP1, ch... 70 5e-10 ref|XP_010663916.1| PREDICTED: plastid division protein CDP1, ch... 68 2e-09 ref|XP_002269313.2| PREDICTED: plastid division protein CDP1, ch... 68 2e-09 ref|XP_007029350.1| ARC6-like protein isoform 1 [Theobroma cacao... 68 2e-09 emb|CBI35272.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_010069515.1| PREDICTED: plastid division protein CDP1, ch... 68 3e-09 ref|XP_010069516.1| PREDICTED: plastid division protein CDP1, ch... 68 3e-09 ref|XP_011072068.1| PREDICTED: plastid division protein CDP1, ch... 65 1e-08 ref|XP_012855630.1| PREDICTED: plastid division protein CDP1, ch... 65 1e-08 gb|KDO46155.1| hypothetical protein CISIN_1g0034421mg, partial [... 65 2e-08 ref|XP_006493425.1| PREDICTED: plastid division protein CDP1, ch... 65 2e-08 ref|XP_006441426.1| hypothetical protein CICLE_v10018888mg [Citr... 65 2e-08 ref|XP_010546465.1| PREDICTED: plastid division protein CDP1, ch... 64 4e-08 ref|XP_010546464.1| PREDICTED: plastid division protein CDP1, ch... 64 4e-08 ref|XP_009145823.1| PREDICTED: plastid division protein CDP1, ch... 62 1e-07 emb|CDX92306.1| BnaA05g21010D [Brassica napus] 62 1e-07 >ref|XP_010275977.1| PREDICTED: plastid division protein CDP1, chloroplastic [Nelumbo nucifera] Length = 827 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/37 (86%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC-GSVM 193 VDESQPKNP YYS+YKIRYLLKRQYDGSWRFC GS++ Sbjct: 788 VDESQPKNPTYYSTYKIRYLLKRQYDGSWRFCEGSIL 824 >ref|XP_011624786.1| PREDICTED: plastid division protein CDP1, chloroplastic [Amborella trichopoda] Length = 833 Score = 71.6 bits (174), Expect = 2e-10 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVMESVA 181 +DESQPKNPNYYS+Y+IRY+LKRQYDG+W+FCG +++ A Sbjct: 794 IDESQPKNPNYYSTYQIRYVLKRQYDGTWKFCGGGIQTPA 833 >gb|ERN09423.1| hypothetical protein AMTR_s00029p00059460 [Amborella trichopoda] Length = 859 Score = 71.6 bits (174), Expect = 2e-10 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVMESVA 181 +DESQPKNPNYYS+Y+IRY+LKRQYDG+W+FCG +++ A Sbjct: 820 IDESQPKNPNYYSTYQIRYVLKRQYDGTWKFCGGGIQTPA 859 >emb|CDO98565.1| unnamed protein product [Coffea canephora] Length = 837 Score = 70.5 bits (171), Expect = 4e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VD+SQPKNPNYYS+YKIRY LKRQYDGSWRFC Sbjct: 798 VDDSQPKNPNYYSTYKIRYYLKRQYDGSWRFC 829 >ref|XP_012434838.1| PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium raimondii] gi|823199215|ref|XP_012434839.1| PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium raimondii] gi|763779014|gb|KJB46137.1| hypothetical protein B456_007G350000 [Gossypium raimondii] gi|763779015|gb|KJB46138.1| hypothetical protein B456_007G350000 [Gossypium raimondii] gi|763779016|gb|KJB46139.1| hypothetical protein B456_007G350000 [Gossypium raimondii] Length = 829 Score = 70.1 bits (170), Expect = 5e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVME 190 VDESQPKNPNYYS+YKIRY+L+RQ DGSW+FCG +E Sbjct: 790 VDESQPKNPNYYSTYKIRYILRRQDDGSWKFCGGDIE 826 >ref|XP_010663916.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform X2 [Vitis vinifera] Length = 706 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYS+YK+RYLL+RQ DGSWRFC Sbjct: 667 VDESQPKNPNYYSTYKVRYLLRRQDDGSWRFC 698 >ref|XP_002269313.2| PREDICTED: plastid division protein CDP1, chloroplastic isoform X1 [Vitis vinifera] Length = 824 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYS+YK+RYLL+RQ DGSWRFC Sbjct: 785 VDESQPKNPNYYSTYKVRYLLRRQDDGSWRFC 816 >ref|XP_007029350.1| ARC6-like protein isoform 1 [Theobroma cacao] gi|508717955|gb|EOY09852.1| ARC6-like protein isoform 1 [Theobroma cacao] Length = 829 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVMES 187 VDES+PKNPNYYS+YKIRY+LKRQ DG W+FCG +E+ Sbjct: 790 VDESEPKNPNYYSTYKIRYILKRQDDGLWKFCGGDIET 827 >emb|CBI35272.3| unnamed protein product [Vitis vinifera] Length = 822 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYS+YK+RYLL+RQ DGSWRFC Sbjct: 783 VDESQPKNPNYYSTYKVRYLLRRQDDGSWRFC 814 >ref|XP_010069515.1| PREDICTED: plastid division protein CDP1, chloroplastic-like isoform X1 [Eucalyptus grandis] Length = 824 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYSSYKIRY+LK+Q DGSW+FC Sbjct: 785 VDESQPKNPNYYSSYKIRYVLKKQEDGSWKFC 816 >ref|XP_010069516.1| PREDICTED: plastid division protein CDP1, chloroplastic-like isoform X2 [Eucalyptus grandis] gi|629091899|gb|KCW57894.1| hypothetical protein EUGRSUZ_H00644 [Eucalyptus grandis] Length = 823 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYSSYKIRY+LK+Q DGSW+FC Sbjct: 784 VDESQPKNPNYYSSYKIRYVLKKQEDGSWKFC 815 >ref|XP_011072068.1| PREDICTED: plastid division protein CDP1, chloroplastic [Sesamum indicum] Length = 831 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDE+QPKNP YYS YKIRYLLKRQ DGSWRFC Sbjct: 792 VDETQPKNPTYYSPYKIRYLLKRQDDGSWRFC 823 >ref|XP_012855630.1| PREDICTED: plastid division protein CDP1, chloroplastic [Erythranthe guttatus] gi|604302737|gb|EYU22294.1| hypothetical protein MIMGU_mgv1a001394mg [Erythranthe guttata] Length = 826 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNP YYS YKIRYLLKRQ DGSW+FC Sbjct: 787 VDESQPKNPTYYSPYKIRYLLKRQGDGSWKFC 818 >gb|KDO46155.1| hypothetical protein CISIN_1g0034421mg, partial [Citrus sinensis] Length = 568 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYSSYKIRY+L+++ DG+WRFC Sbjct: 529 VDESQPKNPNYYSSYKIRYVLRKKDDGTWRFC 560 >ref|XP_006493425.1| PREDICTED: plastid division protein CDP1, chloroplastic-like [Citrus sinensis] Length = 819 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYSSYKIRY+L+++ DG+WRFC Sbjct: 780 VDESQPKNPNYYSSYKIRYVLRKKDDGTWRFC 811 >ref|XP_006441426.1| hypothetical protein CICLE_v10018888mg [Citrus clementina] gi|557543688|gb|ESR54666.1| hypothetical protein CICLE_v10018888mg [Citrus clementina] Length = 812 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFC 205 VDESQPKNPNYYSSYKIRY+L+++ DG+WRFC Sbjct: 773 VDESQPKNPNYYSSYKIRYVLRKKDDGTWRFC 804 >ref|XP_010546465.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform X2 [Tarenaya hassleriana] Length = 797 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVME 190 VDESQPKNP YYS+YKI Y LK+Q DGSWRFC S ++ Sbjct: 754 VDESQPKNPKYYSTYKINYTLKKQEDGSWRFCESEIQ 790 >ref|XP_010546464.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform X1 [Tarenaya hassleriana] Length = 828 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGSVME 190 VDESQPKNP YYS+YKI Y LK+Q DGSWRFC S ++ Sbjct: 785 VDESQPKNPKYYSTYKINYTLKKQEDGSWRFCESEIQ 821 >ref|XP_009145823.1| PREDICTED: plastid division protein CDP1, chloroplastic [Brassica rapa] Length = 807 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGS 199 VDESQPKN YYS+YKIRY LK+Q DGSWRFC S Sbjct: 768 VDESQPKNAKYYSTYKIRYTLKKQEDGSWRFCQS 801 >emb|CDX92306.1| BnaA05g21010D [Brassica napus] Length = 805 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 300 VDESQPKNPNYYSSYKIRYLLKRQYDGSWRFCGS 199 VDESQPKN YYS+YKIRY LK+Q DGSWRFC S Sbjct: 766 VDESQPKNAKYYSTYKIRYTLKKQEDGSWRFCQS 799