BLASTX nr result
ID: Cinnamomum24_contig00011130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00011130 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011649657.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 66 1e-08 ref|XP_011649655.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 66 1e-08 ref|XP_004152653.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 66 1e-08 ref|XP_008444799.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 64 3e-08 ref|XP_008444796.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 64 3e-08 ref|XP_007017787.1| Eukaryotic initiation factor 3 gamma subunit... 64 4e-08 ref|XP_010934213.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 64 5e-08 ref|XP_010934212.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 64 5e-08 ref|XP_010664801.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 63 7e-08 ref|XP_002280127.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 63 7e-08 gb|KHF97948.1| tRNA (adenine(58)-N(1))-methyltransferase non-cat... 63 9e-08 ref|XP_007017789.1| Eukaryotic initiation factor 3 gamma subunit... 63 9e-08 ref|XP_007160671.1| hypothetical protein PHAVU_001G007200g [Phas... 62 1e-07 ref|XP_012073811.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 62 1e-07 gb|KJB58106.1| hypothetical protein B456_009G195100 [Gossypium r... 62 2e-07 ref|XP_012447563.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 62 2e-07 ref|XP_004499247.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 61 3e-07 ref|XP_010104442.1| tRNA (adenine(58)-N(1))-methyltransferase no... 61 3e-07 ref|XP_010530285.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 61 3e-07 ref|XP_009335116.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 61 3e-07 >ref|XP_011649657.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X2 [Cucumis sativus] gi|778671562|ref|XP_011649658.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X3 [Cucumis sativus] Length = 451 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 120 VTVTMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 +T+ SES +NPR+TWEGCSVLLD+NDGDRLVFARLSP+ Sbjct: 3 LTILQSESR-RNPRLTWEGCSVLLDVNDGDRLVFARLSPA 41 >ref|XP_011649655.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Cucumis sativus] gi|778671558|ref|XP_011649656.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Cucumis sativus] gi|700207552|gb|KGN62671.1| hypothetical protein Csa_2G367740 [Cucumis sativus] Length = 452 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 120 VTVTMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 +T+ SES +NPR+TWEGCSVLLD+NDGDRLVFARLSP+ Sbjct: 3 LTILQSESR-RNPRLTWEGCSVLLDVNDGDRLVFARLSPA 41 >ref|XP_004152653.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X4 [Cucumis sativus] Length = 448 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 120 VTVTMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 +T+ SES +NPR+TWEGCSVLLD+NDGDRLVFARLSP+ Sbjct: 3 LTILQSESR-RNPRLTWEGCSVLLDVNDGDRLVFARLSPA 41 >ref|XP_008444799.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X3 [Cucumis melo] Length = 448 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 117 TVTMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 T+ S+S +NPR+TWEGCSVLLD+NDGDRLVFARLSP+ Sbjct: 5 TILQSDSR-RNPRLTWEGCSVLLDVNDGDRLVFARLSPA 42 >ref|XP_008444796.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Cucumis melo] gi|659088091|ref|XP_008444797.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Cucumis melo] Length = 452 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 117 TVTMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 T+ S+S +NPR+TWEGCSVLLD+NDGDRLVFARLSP+ Sbjct: 5 TILQSDSR-RNPRLTWEGCSVLLDVNDGDRLVFARLSPA 42 >ref|XP_007017787.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma cacao] gi|508723115|gb|EOY15012.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma cacao] Length = 451 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 MSE+ PQ NPR+TWEGCSVLLDINDGDRLVFARLS Sbjct: 1 MSENKPQSDSIQNPRVTWEGCSVLLDINDGDRLVFARLS 39 >ref|XP_010934213.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X2 [Elaeis guineensis] Length = 470 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 93 PQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 P NPR TWEGCSVLLDINDGDRLVFARLSP+ Sbjct: 16 PPNPRTTWEGCSVLLDINDGDRLVFARLSPA 46 >ref|XP_010934212.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Elaeis guineensis] Length = 505 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 93 PQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 P NPR TWEGCSVLLDINDGDRLVFARLSP+ Sbjct: 16 PPNPRTTWEGCSVLLDINDGDRLVFARLSPA 46 >ref|XP_010664801.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X2 [Vitis vinifera] Length = 303 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 111 TMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 ++ + QNPR+TWEGCSVLLDINDGDRLVFARLS S Sbjct: 5 SLQNDSIQNPRVTWEGCSVLLDINDGDRLVFARLSAS 41 >ref|XP_002280127.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 isoform X1 [Vitis vinifera] gi|302142647|emb|CBI19850.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 111 TMSESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 ++ + QNPR+TWEGCSVLLDINDGDRLVFARLS S Sbjct: 5 SLQNDSIQNPRVTWEGCSVLLDINDGDRLVFARLSAS 41 >gb|KHF97948.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Gossypium arboreum] Length = 453 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 MSE+ P+ NPR+TWEGCSVLLDINDGDRLVFARLS Sbjct: 1 MSENKPESGPTVNPRVTWEGCSVLLDINDGDRLVFARLS 39 >ref|XP_007017789.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma cacao] gi|508723117|gb|EOY15014.1| Eukaryotic initiation factor 3 gamma subunit family protein [Theobroma cacao] Length = 417 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 MSE PQ NPR+TWEGCSVLLDINDGDRLVFARLS Sbjct: 1 MSEYKPQSDSIQNPRVTWEGCSVLLDINDGDRLVFARLS 39 >ref|XP_007160671.1| hypothetical protein PHAVU_001G007200g [Phaseolus vulgaris] gi|561034135|gb|ESW32665.1| hypothetical protein PHAVU_001G007200g [Phaseolus vulgaris] Length = 470 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 105 SESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 S SN + R+TWEGCSVLLDINDGDRLVFARLSP+ Sbjct: 4 SNSNSNSGRVTWEGCSVLLDINDGDRLVFARLSPA 38 >ref|XP_012073811.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Jatropha curcas] gi|643728997|gb|KDP36934.1| hypothetical protein JCGZ_08225 [Jatropha curcas] Length = 445 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 90 QNPRITWEGCSVLLDINDGDRLVFARLSP 4 QNPR+TWEGCSVLLDINDGDRLVF+RL+P Sbjct: 12 QNPRVTWEGCSVLLDINDGDRLVFSRLTP 40 >gb|KJB58106.1| hypothetical protein B456_009G195100 [Gossypium raimondii] Length = 439 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 MSE+ P+ NPR+TWEGCSVLLDINDGDRL+FARLS Sbjct: 1 MSENKPESGPTVNPRVTWEGCSVLLDINDGDRLLFARLS 39 >ref|XP_012447563.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Gossypium raimondii] gi|763791109|gb|KJB58105.1| hypothetical protein B456_009G195100 [Gossypium raimondii] Length = 489 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 MSE+ P+ NPR+TWEGCSVLLDINDGDRL+FARLS Sbjct: 37 MSENKPESGPTVNPRVTWEGCSVLLDINDGDRLLFARLS 75 >ref|XP_004499247.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Cicer arietinum] Length = 439 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 105 SESNPQNPRITWEGCSVLLDINDGDRLVFARLSPS 1 SE+ + RITWEGCSVLLDINDGDRLVFARLSP+ Sbjct: 3 SENKEASSRITWEGCSVLLDINDGDRLVFARLSPA 37 >ref|XP_010104442.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Morus notabilis] gi|587913154|gb|EXC00975.1| tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Morus notabilis] Length = 448 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 90 QNPRITWEGCSVLLDINDGDRLVFARLS 7 QNPR+TWEGCSVLLDINDGDRLVFARLS Sbjct: 12 QNPRMTWEGCSVLLDINDGDRLVFARLS 39 >ref|XP_010530285.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Tarenaya hassleriana] Length = 447 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 105 SESNPQNPRITWEGCSVLLDINDGDRLVFARLS 7 S+ NP NPR+TW+GCSVLLDINDGDRLVFARLS Sbjct: 10 SDRNP-NPRVTWDGCSVLLDINDGDRLVFARLS 41 >ref|XP_009335116.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 [Pyrus x bretschneideri] Length = 451 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 5/39 (12%) Frame = -2 Query: 108 MSESNPQ-----NPRITWEGCSVLLDINDGDRLVFARLS 7 +SES PQ NPR TW+GCSVLLDINDGDRLVFARLS Sbjct: 3 ISESKPQIELSENPRATWDGCSVLLDINDGDRLVFARLS 41