BLASTX nr result
ID: Cinnamomum24_contig00009996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00009996 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516625.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >ref|XP_002516625.1| conserved hypothetical protein [Ricinus communis] gi|223544227|gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 15 YGQIPLKTVRAGLPACGSRHSRWPSPAFIRKSCSEI 122 + Q+PLKTV AGLP CGS HSRW SPAFI KSCS + Sbjct: 46 FDQVPLKTVCAGLPTCGSCHSRWSSPAFIHKSCSSL 81