BLASTX nr result
ID: Cinnamomum24_contig00009348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00009348 (809 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105821.1| hypothetical protein L484_004704 [Morus nota... 64 1e-07 >ref|XP_010105821.1| hypothetical protein L484_004704 [Morus notabilis] gi|587918934|gb|EXC06420.1| hypothetical protein L484_004704 [Morus notabilis] Length = 195 Score = 63.9 bits (154), Expect = 1e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 807 SYFQKKGQTQGSCDFSSTAVAVTTDPSPSTTCAFPSSA 694 SYFQKKGQ QG+CDFS TA VT+DPS S+TCA+P++A Sbjct: 72 SYFQKKGQAQGTCDFSGTATVVTSDPSTSSTCAYPATA 109