BLASTX nr result
ID: Cinnamomum24_contig00008332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00008332 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010485744.1| PREDICTED: auxin-induced protein 15A [Cameli... 77 6e-12 ref|XP_010514943.1| PREDICTED: auxin-induced protein 15A-like [C... 77 6e-12 gb|KFK23434.1| hypothetical protein AALP_AAs63894U000200 [Arabis... 75 1e-11 ref|XP_011037241.1| PREDICTED: uncharacterized protein LOC105134... 75 2e-11 ref|XP_006296650.1| hypothetical protein CARUB_v10015547mg, part... 75 2e-11 ref|XP_002306153.1| hypothetical protein POPTR_0004s17280g [Popu... 75 2e-11 ref|XP_006384539.1| hypothetical protein POPTR_0004s17250g [Popu... 75 2e-11 ref|XP_009126229.1| PREDICTED: auxin-induced protein 15A-like [B... 74 4e-11 ref|XP_012084411.1| PREDICTED: auxin-induced protein 15A-like [J... 74 4e-11 ref|XP_002272387.1| PREDICTED: auxin-induced protein 15A-like [V... 74 4e-11 emb|CAN62606.1| hypothetical protein VITISV_016867 [Vitis vinifera] 74 4e-11 ref|XP_008448012.1| PREDICTED: auxin-induced protein 15A-like [C... 74 5e-11 ref|XP_012084413.1| PREDICTED: auxin-induced protein 15A-like [J... 74 5e-11 ref|XP_012084407.1| PREDICTED: auxin-induced protein 15A-like [J... 73 6e-11 gb|KDO46704.1| hypothetical protein CISIN_1g036136mg [Citrus sin... 73 6e-11 ref|XP_006487294.1| PREDICTED: auxin-induced protein 10A5-like [... 73 6e-11 ref|XP_006423540.1| hypothetical protein CICLE_v10029650mg [Citr... 73 6e-11 ref|XP_007041982.1| SAUR-like auxin-responsive protein family [T... 73 6e-11 ref|XP_010105322.1| hypothetical protein L484_000538 [Morus nota... 73 8e-11 ref|XP_011658572.1| PREDICTED: auxin-induced protein 15A-like [C... 73 8e-11 >ref|XP_010485744.1| PREDICTED: auxin-induced protein 15A [Camelina sativa] Length = 95 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQDLLS+AEEEFGFDH MGGLTIPC EDTFIS+TSQL Sbjct: 55 PSFQDLLSKAEEEFGFDHPMGGLTIPCPEDTFISITSQL 93 >ref|XP_010514943.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa] Length = 94 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQDLLS+AEEEFGFDH MGGLTIPC EDTFIS+TSQL Sbjct: 54 PSFQDLLSKAEEEFGFDHPMGGLTIPCPEDTFISITSQL 92 >gb|KFK23434.1| hypothetical protein AALP_AAs63894U000200 [Arabis alpina] Length = 95 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQ LLS+AEEEFGF+H MGGLTIPCHEDTFIS+TSQL Sbjct: 55 PSFQALLSKAEEEFGFNHPMGGLTIPCHEDTFISITSQL 93 >ref|XP_011037241.1| PREDICTED: uncharacterized protein LOC105134501 [Populus euphratica] Length = 194 Score = 75.1 bits (183), Expect = 2e-11 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS*VMSITRI*KA*LFVLIL 174 PSFQ+LLS+AEEE+GFDHQMGGLTIPC ED FI +TS+LN + ++TR A L IL Sbjct: 53 PSFQELLSKAEEEYGFDHQMGGLTIPCREDIFIDLTSRLNAN---TMTRHPAAALAKKIL 109 Query: 173 TESLQEVN 150 S+ N Sbjct: 110 QRSVWNAN 117 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSFQDLL++AEEEFGF+H MGGLTIPC ED F V S L+ S Sbjct: 153 PSFQDLLTKAEEEFGFNHPMGGLTIPCREDKFNDVLSSLSRS 194 >ref|XP_006296650.1| hypothetical protein CARUB_v10015547mg, partial [Capsella rubella] gi|482565359|gb|EOA29548.1| hypothetical protein CARUB_v10015547mg, partial [Capsella rubella] Length = 102 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQDLLS+ EEEFGFDH MGGLTIPC EDTFIS+TSQL Sbjct: 62 PSFQDLLSKGEEEFGFDHPMGGLTIPCPEDTFISITSQL 100 >ref|XP_002306153.1| hypothetical protein POPTR_0004s17280g [Populus trichocarpa] gi|566167002|ref|XP_006384538.1| hypothetical protein POPTR_0004s17240g [Populus trichocarpa] gi|222849117|gb|EEE86664.1| hypothetical protein POPTR_0004s17280g [Populus trichocarpa] gi|550341222|gb|ERP62335.1| hypothetical protein POPTR_0004s17240g [Populus trichocarpa] Length = 94 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSFQ+LLS+AEEE+GFDHQMGGLTIPC ED FI +TS+LN S Sbjct: 53 PSFQELLSKAEEEYGFDHQMGGLTIPCREDIFIDLTSRLNAS 94 >ref|XP_006384539.1| hypothetical protein POPTR_0004s17250g [Populus trichocarpa] gi|550341223|gb|ERP62336.1| hypothetical protein POPTR_0004s17250g [Populus trichocarpa] Length = 94 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSFQ+LLS+AEEE+GFDHQMGGLTIPC ED FI +TS+LN S Sbjct: 53 PSFQELLSKAEEEYGFDHQMGGLTIPCREDIFIDLTSRLNAS 94 >ref|XP_009126229.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa] Length = 92 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQ LLS++EEEFGFDH MGGLTIPCHEDTFI+VTS+L Sbjct: 53 PSFQALLSKSEEEFGFDHPMGGLTIPCHEDTFITVTSRL 91 >ref|XP_012084411.1| PREDICTED: auxin-induced protein 15A-like [Jatropha curcas] gi|643715672|gb|KDP27613.1| hypothetical protein JCGZ_19618 [Jatropha curcas] Length = 96 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSFQDLLS+AEEE+GFDH MGGLTIPC EDTFI VTS L+ S Sbjct: 55 PSFQDLLSKAEEEYGFDHPMGGLTIPCREDTFIDVTSSLSRS 96 >ref|XP_002272387.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera] gi|731383022|ref|XP_010647418.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera] Length = 100 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 P FQDLL RAEEEFGFDH MGGLTIPC ED FIS+TS L+CS Sbjct: 59 PLFQDLLHRAEEEFGFDHPMGGLTIPCSEDYFISLTSHLSCS 100 >emb|CAN62606.1| hypothetical protein VITISV_016867 [Vitis vinifera] Length = 75 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 P FQDLL RAEEEFGFDH MGGLTIPC ED FIS+TS L+CS Sbjct: 34 PLFQDLLHRAEEEFGFDHPMGGLTIPCSEDYFISLTSHLSCS 75 >ref|XP_008448012.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo] Length = 84 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL-NC 231 PSFQDLLS+AEEEFGFDH MGGLTIPC+ED F+ VTS+L NC Sbjct: 43 PSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFLKVTSRLANC 84 >ref|XP_012084413.1| PREDICTED: auxin-induced protein 15A-like [Jatropha curcas] gi|643715676|gb|KDP27617.1| hypothetical protein JCGZ_19622 [Jatropha curcas] Length = 95 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL 237 PSFQDLLSRAEEE+GFDH MGGLTIPC EDTFI VTS L Sbjct: 54 PSFQDLLSRAEEEYGFDHPMGGLTIPCREDTFIYVTSSL 92 >ref|XP_012084407.1| PREDICTED: auxin-induced protein 15A-like [Jatropha curcas] gi|643715668|gb|KDP27609.1| hypothetical protein JCGZ_19614 [Jatropha curcas] Length = 96 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSFQDLLS+AEEE+GFDH MGGLTIPC EDTFI VTS+L S Sbjct: 55 PSFQDLLSKAEEEYGFDHPMGGLTIPCGEDTFIDVTSRLTRS 96 >gb|KDO46704.1| hypothetical protein CISIN_1g036136mg [Citrus sinensis] Length = 100 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLN 234 PSFQ+LLS+AEEEFGFDH MGGLTIPC ED FI+VTS LN Sbjct: 59 PSFQELLSKAEEEFGFDHPMGGLTIPCREDIFINVTSSLN 98 >ref|XP_006487294.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis] Length = 100 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLN 234 PSFQ+LLS+AEEEFGFDH MGGLTIPC ED FI+VTS LN Sbjct: 59 PSFQELLSKAEEEFGFDHPMGGLTIPCREDIFINVTSSLN 98 >ref|XP_006423540.1| hypothetical protein CICLE_v10029650mg [Citrus clementina] gi|557525474|gb|ESR36780.1| hypothetical protein CICLE_v10029650mg [Citrus clementina] Length = 100 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLN 234 PSFQ+LLS+AEEEFGFDH MGGLTIPC ED FI+VTS LN Sbjct: 59 PSFQELLSKAEEEFGFDHPMGGLTIPCREDIFINVTSSLN 98 >ref|XP_007041982.1| SAUR-like auxin-responsive protein family [Theobroma cacao] gi|508705917|gb|EOX97813.1| SAUR-like auxin-responsive protein family [Theobroma cacao] Length = 202 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLN 234 PSFQ LLS++EEEFGFDH MGGLTIPC E+TFI+VTSQLN Sbjct: 162 PSFQALLSKSEEEFGFDHPMGGLTIPCREETFINVTSQLN 201 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLN 234 PSFQ LLS AEEEFGF+H MGGLTIPC E+ FI +TS+L+ Sbjct: 59 PSFQKLLSIAEEEFGFNHPMGGLTIPCREEVFIDLTSRLS 98 >ref|XP_010105322.1| hypothetical protein L484_000538 [Morus notabilis] gi|587965627|gb|EXC50771.1| hypothetical protein L484_000538 [Morus notabilis] Length = 99 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQLNCS 228 PSF++LL RAEEEFGF+H MGGLTIPC EDTFI +TSQLN S Sbjct: 57 PSFRELLKRAEEEFGFNHPMGGLTIPCREDTFIHLTSQLNIS 98 >ref|XP_011658572.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] gi|700187964|gb|KGN43197.1| hypothetical protein Csa_7G008440 [Cucumis sativus] Length = 84 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/42 (80%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -1 Query: 353 PSFQDLLSRAEEEFGFDHQMGGLTIPCHEDTFISVTSQL-NC 231 PSFQDLLS+AEEEFGFDH MGGLTIPC+ED F VTS+L NC Sbjct: 43 PSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFFEVTSRLANC 84